| PDBID: | 9bs9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 | | Release date: | 2025-11-12 |
|
| PDBID: | 9bsb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 | | Release date: | 2025-11-12 |
|
| PDBID: | 8zif | | Status: | HOLD -- hold until a certain date | | Title: | Gamma-lyase CndF in complex with pyridoxal 5''-phosphate, L-homoserine and ethyl acetoacetate | | Authors: | Gao, Y., Zhou, J. | | Deposition date: | 2024-05-13 | | Release date: | 2025-11-13 |
|
| PDBID: | 9fbb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 | | Release date: | 2025-11-13 |
|
| PDBID: | 9fbe | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | 3-keto-glycoside eliminase/hydratase in komplex with 2-hydroxy-3-keto-glucal | | Authors: | Pfeiffer, M., Kastner, K., Oberdorfer, G., Nidetzky, B. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9brk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL098-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 | | Release date: | 2025-11-10 |
|
| PDBID: | 9brl | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL080-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 | | Release date: | 2025-11-10 |
|
| PDBID: | 9brm | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL077-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 | | Release date: | 2025-11-10 |
|
| PDBID: | 9brn | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL050-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 | | Release date: | 2025-11-10 |
|
| PDBID: | 9bro | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL030-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 | | Release date: | 2025-11-10 |
|
| PDBID: | 9brp | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL047-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 | | Release date: | 2025-11-10 |
|
| PDBID: | 8zhr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-11 | | Release date: | 2025-11-11 |
|
| PDBID: | 8zh0 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with metal Iron | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Release date: | 2025-11-10 | | Sequence: | >Entity 1
MGSSWSHPQFEKMSTVDTAPQSHYQETKVSEIPIVILKSSATDDVAAHEAIEALKVAGVCIVRNLLDRSTVDKVRQELQPYDKQADSFEGFPKNYCQVAGLLSKSPTYAHSIVGNKLFTAVRNYFLTSTYECWAEKGTWMSVKSPPQLDSTLALYVNPGSGDQGLHRDDATQQNWNSGASEYSLGRDSGCAMMVALTECAREDGTTRFIPGSHLWDYQYDHPSNDDPRIRYAEMRPGDAYLMLSSVIHAGSVNYSTDRRRVLAAVFAARSHLRQVENQYLTYDIETVRTFPTWLQRFMGYSLSKLFQGWVDKKDPLLVVDPNAQPEGEDDGGMKPNEGEHVVEAQI
|
|
| PDBID: | 9br5 | | Status: | HPUB -- hold until publication | | Title: | IL1RAP-specific Fab | | Authors: | Mallett, T.C., Williams, J.C., Park, M. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9bqw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh1 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Release date: | 2025-11-10 |
|
| PDBID: | 8zh2 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate and Communesin K | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Release date: | 2025-11-10 |
|
| PDBID: | 8zgl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 | | Release date: | 2025-11-09 |
|
| PDBID: | 8zgk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 | | Release date: | 2025-11-09 |
|
| PDBID: | 8zgn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 | | Release date: | 2025-11-09 |
|
| PDBID: | 8zgm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 | | Release date: | 2025-11-09 |
|
| PDBID: | 8zgj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 | | Release date: | 2025-11-09 |
|
| PDBID: | 9bpl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-07 |
|
| PDBID: | 8zff | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-07 | | Release date: | 2025-11-07 |
|
| PDBID: | 8zfg | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-07 | | Release date: | 2025-11-07 |
|
