| PDBID: | 9j0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j02 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of RhoA-TP1001 complex | | Authors: | Zhu, L., Li, H., Chang, L., Hu, X. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j05 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j04 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j06 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0d | | Status: | HPUB -- hold until publication | | Title: | Apo structure of ketoreductase AsuC7 from Asukamycin polyketide Synthases | | Authors: | Dai, Y., Qu, X. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0e | | Status: | HPUB -- hold until publication | | Title: | Catalyst-free photoinitiated intramolecular carbon-carbon coupling enables the efficient synthesis of pharmaceutically important biaryls | | Authors: | Yang, L., Qu, X.D. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-02 | | Release date: | 2025-08-02 |
|
| PDBID: | 9j0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cye | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 | | Sequence: | >Entity 1
GSGSMELRSITVESWDNPAASAAYGWEVFTDKDTQQAQGAQPQAYQPVAQNAQSLREVKLIAGKPGDIKNVDAGTAKVLGVKFQFTYPGDNSVTIRPPRVPEYEVLRTKSYLDANNQRKVSKIYGVEFPGVSKAISVWV(YCM)GRGNEYNLEGWIEDWKGDTHILQFGSLDFIGWRPLTVGIPQGVPQDVNSYPQVKTIVFKQFKIRSRPDTSGETVYLFFDELRVLSDVFEVHFDGASIDFDDEDCKSKHKLDKMLKTK
|
|
| PDBID: | 9gcr | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-1-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcp | | Status: | HPUB -- hold until publication | | Title: | ChREBP/14-3-3 complex stabilized by AMP | | Authors: | Moschref, M., Heimhalt, M., Pysik, T., Menzer, W.M., Basquin, J., Margulies, C.E., Ladurner, A.G. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcn | | Status: | HPUB -- hold until publication | | Title: | Co-crystal VHH (TPL1158_01_C09) - alpha-cobratoxin (Naja kaouthia) | | Authors: | Rivera-de-Torre, E., Burlet, N.J., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcq | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-2-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9iz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus complexed with C37 Fab, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
