| PDBID: | 8kdv | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Oval fibril at 3.5 Angstroms resolution | | Authors: | Li, D., Zhang, X., Zhu, P. | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-26 |
|
| PDBID: | 8kdz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-10 |
|
| PDBID: | 8trz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-09 |
|
| PDBID: | 8trw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-10 |
|
| PDBID: | 8kdn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8kdd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8kdf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8kdg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8kdh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8kdi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8kdj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8kdo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8kdp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8trf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8q55 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8q5c | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 12 (1075475) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8kcy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8kd1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8tqy | | Status: | HPUB -- hold until publication | | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | | Deposition date: | 2023-08-08 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8q4c | | Status: | AUCO -- author corrections pending review | | Title: | Human PEX5 TPR domain in complex with PEX14 KIPSWQIPV peptide | | Authors: | Emmanouilidis, L., Gaussmann, S., Sattler, M. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tq4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8kbn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
