| PDBID: | 9vwz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Local refinement region of HPV45 in complex with antibody A16E6 | | Authors: | Jiang, Y., Sun, H., Zheng, Q., Li, S. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | human OSM in complex with Nb3.30 | | Authors: | Wen, Y. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwp | | Status: | HPUB -- hold until publication | | Title: | human OSM in complex with Nb3.43 | | Authors: | Wen, Y. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vws | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Nanobody Nb3.30 | | Authors: | Wen, Y. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s11 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s0u | | Status: | HPUB -- hold until publication | | Title: | State 3 MAP 3 RNA Pol II activated elongation complex with SETD2 bound to distal upstream H3 | | Authors: | Walshe, J.L., Ochmann, M., Dienemann, C., Cramer, P. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s0t | | Status: | HPUB -- hold until publication | | Title: | Superfolder green fluorescent protein (sfGFP) exhibiting p-(phenylazo)-L-phenylalanine (Pap) at position 39 in complex with alpha-cyclodextrin | | Authors: | Eichinger, A., Skerra, A. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s0w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s0z | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s12 | | Status: | HPUB -- hold until publication | | Title: | Protein with 6_3 knot. | | Authors: | Mozajew, M., Sikora, M., Garstka, W., Sulkowska, J.I. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s0y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s15 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s10 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s16 | | Status: | HPUB -- hold until publication | | Title: | Apo-state RyR1 in the native membrane solved by ""SPA | | Authors: | Mikirtumov, V. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s0x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MfAlfAGH29, a family 29 glycoside hydrolase from the marine bacterium Mariniflexile fucanivorans | | Authors: | Roret, T., Jam, M., Czjzek, M., Michel, G. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s13 | | Status: | HPUB -- hold until publication | | Title: | Focused refinement of Rhodospirillum rubrum encapsulated ferritin within the encapsulin nanocompartment | | Authors: | McIver, Z., McCorvie, T.J., Basle, A., Marles-Wright, J. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s0v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9s14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9pm1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an engineered PETase, EV2, derived from Thermobifida fusca cutinase (TfCut2) | | Authors: | Mathews, I.I., Norton-Baker, B., Storment, O.O., McGeehan, J.E., Beckham, G.T., Gauthier, N.P. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9pmb | | Status: | HPUB -- hold until publication | | Title: | Kinesin-1 heterotetramer | | Authors: | Ashaduzzaman, M., Al-Bassam, J. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9pm0 | | Status: | HPUB -- hold until publication | | Title: | nucleosome containing histone variant macroH2A | | Authors: | Tan, D., Sokolova, V. | | Deposition date: | 2025-07-16 | | Sequence: | >Entity 1
MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKK
>Entity 2
PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
>Entity 3
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
>Entity 4
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
>Entity 5
(DA)(DC)(DT)(DT)(DA)(DT)(DG)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DC)(DC)(DC)(DT)(DA)(DT)(DA)(DC)(DG)(DC)(DG)(DG)(DC)(DC)(DG)(DC)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DG)(DC)(DA)(DT)(DG)(DT)(DA)(DT)(DT)(DG)(DA)(DA)(DC)(DA)(DG)(DC)(DG)(DA)(DC)(DC)(DT)(DT)(DG)(DC)(DC)(DG)(DG)(DA)(DG)(DT)
>Entity 6
(DA)(DC)(DT)(DC)(DC)(DG)(DG)(DC)(DA)(DA)(DG)(DG)(DT)(DC)(DG)(DC)(DT)(DG)(DT)(DT)(DC)(DA)(DA)(DT)(DA)(DC)(DA)(DT)(DG)(DC)(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DG)(DC)(DG)(DG)(DC)(DC)(DG)(DC)(DG)(DT)(DA)(DT)(DA)(DG)(DG)(DG)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DC)(DA)(DT)(DA)(DA)(DG)(DT)
>Entity 7
MKSSHHHHHHENLYFQSNAMDIKMTQSPSSMHASLGERVTITCKASQDIRSYLSWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDFSLTINNLESDDTATYYCLQHGESPYTFGSGTKLEIKRAGGGGSGGGGSGGGGSGGGGSMEVQLQQSGPELVEPGTSVKMPCKASGYTFTSYTIQWVKQTPRQGLEWIGYIYPYNAGTKYNEKFKGKATLTSDKSSSTVYMELSSLTSEDSAVYYCARKSSRLRSTLDYWGQGTSVTVSS
|
|
