| PDBID: | 9pit | | Status: | HPUB -- hold until publication | | Title: | HIV-1 bnAb 1-23 in complex with BG505 MD39 SOSIP and RM19R | | Authors: | Bader, D.L.V., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9pj2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of non-haem diiron azetidine synthase from Streptomyces cacaoi var. asoensis complexed with iron, L-isoleucine and molecular oxygen | | Authors: | Shen, Y., Zheng, Y.-C., Chang, W.-c. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9piv | | Status: | HPUB -- hold until publication | | Title: | HIV-1 bnAb 9-71 in complex with BG505 MD39 SOSIP and RM19R | | Authors: | Bader, D.L.V., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9pir | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an engineered thermostable MHETase, MHT077, E47A variant | | Authors: | Mathews, I.I., Murphy, N., Garcia, R., Sarangi, R., McGeehan, J., Beckham, G.T., Gauthier, N.P. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9piz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9pis | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ab initio structure of crambin by MicroED | | Authors: | Vasireddy, P.C.R., Low-Beer, T., Spoth, K.A., Acehan, D., Crawley, M.R., Martynowycz, M.W. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9pj1 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a synthetic Fab (4R) in complex with the ternary assembly of FKBP12, Rapamycin, and the FRB domain of mTOR | | Authors: | O''Leary, K.M., Slezak, T., Kossiakoff, A.A. | | Deposition date: | 2025-07-11 | | Release date: | 2026-07-11 |
|
| PDBID: | 9piw | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a synthetic Fab (1A) in complex with the FRB domain of mTOR | | Authors: | O''Leary, K.M., Slezak, T., Le, D.A., Kossiakoff, A.A. | | Deposition date: | 2025-07-11 | | Release date: | 2026-07-11 |
|
| PDBID: | 9pix | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9pj3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Non-haem Diiron Azetidine Synthase from Streptomyces cacaoi var. asoensis complexed with manganese and (R)-2-amino-3-methylbut-3-enoic acid | | Authors: | Shen, Y., Zheng, Y.-C., Chang, W.-c. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9pj4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9vtt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-11 | | Sequence: | >Entity 1
GSHMGDLAALSTPPKFDDVEEEKRYLKERLALACRIFAQYGLDHHVAGHLTVRVPGDQNSFYVNPFGLAFQLMTAEDIITVSHTGEVIGGGKRGRQVVNAAGFLIHSAIHKARPDVQAICHSHSPYGKAWSTLGLPLEYTTQDSCAFYKSQAVLDSFGGVVLSKSEGGRIAEKLGDNKLIVLQNHGLLTVGRTIDSAVAWFLLAEEQCKVSLLARAAGQPIPISDEEAEFTSHTGKEEAGFFLASPYFQVAEQKWGKEVRA
|
|
| PDBID: | 9vts | | Status: | HPUB -- hold until publication | | Title: | EBOV GP/1A10-VHH complex | | Authors: | Wang, M., Gong, P., Jin, T. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9vtx | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Congo Red-bound ATTRA97S amyloid fibrils extracted from patient-derived abdominal adipose biopsy tissu | | Authors: | Ma, B.Y., Yao, Y.X., Li, D., Liu, C. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9vtw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ATTRA97S amyloid fibrils extracted from patient-derived abdominal adipose biopsy tissue. | | Authors: | Ma, B.Y., Yao, Y.X., Li, D., Liu, C. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9vty | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ThS-bound ATTRA97S amyloid fibrils extracted from patient-derived abdominal adipose biopsy tissue. | | Authors: | Ma, B.Y., Yao, Y.X., Li, D., Liu, C. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9vtv | | Status: | HPUB -- hold until publication | | Title: | Chitinase TfeC from Yersinia pseudotuberculosis | | Authors: | Zhu, L.F., Zuo, Y.X., Cui, R., Li, D.F., Liu, S.J., Shen, X.H. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9vtp | | Status: | PROC -- to be processed | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9vtq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9vtr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9vtu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9rxf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E20K/N28G/V36L/D43K/Q48E/I59A/E61K/E72K/V76L/N79S/I92A/D126K/A142V/D153K/D154E/S158T FLAVODOXIN FROM ANABAENA | | Authors: | Martinez-Julvez, M., Perez-Correa, V., Sancho, J., Hidalgo-Toledo, A. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9rxi | | Status: | HPUB -- hold until publication | | Title: | Schistosoma mansoni Cathepsin D bound to Nb_10C9 | | Authors: | Parker, K., Clarke, J.D., Owens, R.J. | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9rxr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-11 |
|
| PDBID: | 9rxs | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-11 |
|
