| PDBID: | 9vrm | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vrh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vri | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vrj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vrl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vrk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vr7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vr8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vr6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vr9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vr5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vrb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vrg | | Status: | HPUB -- hold until publication | | Title: | Carbonyl reductase SxPR mutant-T149AF153A | | Authors: | Zhen, M., Tingting, Y. | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vrd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vre | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vrc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Oryza sativa multidrug resistance protein 5 (MRP5) | | Authors: | Zou, J., Zhang, J., Liu, Z. | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9ruy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9ruz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human carbonic anhydrase II in complex with the inhibitor Aprocitentan | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9rv0 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human carbonic anhydrase I in complex with Aprocitentan | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2025-07-06 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9rv1 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vqz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-07-05 | | Release date: | 2026-07-05 |
|
| PDBID: | 9pfl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-05 |
|
| PDBID: | 9vqo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-05 |
|
| PDBID: | 9vqp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-05 |
|
| PDBID: | 9vr3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-05 |
|
