| PDBID: | 9pgg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pfw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pfx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pgb | | Status: | HPUB -- hold until publication | | Title: | 4-module Cysteine Rich Eggshell Membrane Protein (CREMP) | | Authors: | Zeinalilathori, S., Russell, R.W., Ross, J., Modla, S., Caplan, J., Polenova, T., Thorpe, C. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pgh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pg8 | | Status: | AUCO -- author corrections pending review | | Title: | In situ structure of the human mitoribosome in the P-E state | | Authors: | Wang, S., Xiong, Y., Zhang, Y. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pfz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pgc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pg9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of UBR2-AF27 complex | | Authors: | Huang, S., Wu, J., Taylor, S., Chen, Y. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pgd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pgf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | In situ structure of the human mitoribosome in the P state | | Authors: | Wang, S., Xiong, Y., Zhang, Y. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pge | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-07-07 | | Release date: | 2026-07-07 |
|
| PDBID: | 9pgi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | In situ structure of the human mitoribosome in the A-P-E state with TACO1 | | Authors: | Wang, S., Xiong, Y., Zhang, Y. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrv | | Status: | HPUB -- hold until publication | | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 1.41 angstrom resolution | | Authors: | Brito, J.A., Orr, C.M., Wagner, A., Goswami, A. | | Deposition date: | 2025-07-07 | | Sequence: | >Entity 1
MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
| PDBID: | 9vrq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrn | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of endo-beta-1,4-mannanase R318K mutant | | Authors: | Hirano, Y., Naka, Y., Ueda, M., Tamada, T. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vro | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of endo-beta-1,4-mannanase R318A mutant | | Authors: | Hirano, Y., Naka, Y., Ueda, M., Tamada, T. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrp | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of endo-beta-1,4-mannanase D316N mutant | | Authors: | Hirano, Y., Naka, Y., Ueda, M., Tamada, T. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vru | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vry | | Status: | HPUB -- hold until publication | | Title: | Carbonyl reductase SxPR mutant-Q158AM198A | | Authors: | Zhen, M., Tingting, Y. | | Deposition date: | 2025-07-07 |
|
