| PDBID: | 7iji | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z8990523172 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-07-22 |
|
| PDBID: | 7ijj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z8990919037 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-07-22 |
|
| PDBID: | 7ijk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z8990919048 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-07-22 |
|
| PDBID: | 7ijl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z8990523194 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-07-22 |
|
| PDBID: | 7ijm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z7534253453 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-07-22 |
|
| PDBID: | 9s2q | | Status: | HPUB -- hold until publication | | Title: | NH-triazol-modified insulin | | Authors: | Hadzi, S., Gazvoda, M. | | Deposition date: | 2025-07-22 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
|
| PDBID: | 9s2u | | Status: | HPUB -- hold until publication | | Title: | 1:1 complex of M.tuberculosis MmpL5 and M.smegmatis AcpM | | Authors: | Fountain, A.J., Luisi, B.F., Ramakrishan, L. | | Deposition date: | 2025-07-22 |
|
| PDBID: | 9s2s | | Status: | HPUB -- hold until publication | | Title: | Primed-state RyR1 with calcium in activating concentration in the native membrane | | Authors: | Mikirtumov, V. | | Deposition date: | 2025-07-22 |
|
| PDBID: | 9s2r | | Status: | HPUB -- hold until publication | | Title: | Up""-class, Primed-state RyR1 with calcium in activating concentration in the native membrane | | Authors: | Mikirtumov, V. | | Deposition date: | 2025-07-22 |
|
| PDBID: | 9s2v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-22 |
|
| PDBID: | 9ppp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pon | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9poo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pop | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9poq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9por | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pos | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pot | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pou | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pov | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pow | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pox | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9poz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pp0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pp1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-21 |
|
