PDBID: | 7iji | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z8990523172 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2025-07-22 |
|
PDBID: | 7ijj | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z8990919037 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2025-07-22 |
|
PDBID: | 7ijk | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z8990919048 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2025-07-22 |
|
PDBID: | 7ijl | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z8990523194 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2025-07-22 |
|
PDBID: | 7ijm | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with Z7534253453 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2025-07-22 |
|
PDBID: | 9s2q | Status: | HPUB -- hold until publication | Title: | NH-triazol-modified insulin | Authors: | Hadzi, S., Gazvoda, M. | Deposition date: | 2025-07-22 | Sequence: | >Entity 1 GIVEQCCTSICSLYQLENYCN
>Entity 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
|
PDBID: | 9s2u | Status: | HPUB -- hold until publication | Title: | 1:1 complex of M.tuberculosis MmpL5 and M.smegmatis AcpM | Authors: | Fountain, A.J., Luisi, B.F., Ramakrishan, L. | Deposition date: | 2025-07-22 |
|
PDBID: | 9s2s | Status: | HPUB -- hold until publication | Title: | Primed-state RyR1 with calcium in activating concentration in the native membrane | Authors: | Mikirtumov, V. | Deposition date: | 2025-07-22 |
|
PDBID: | 9s2r | Status: | HPUB -- hold until publication | Title: | Up""-class, Primed-state RyR1 with calcium in activating concentration in the native membrane | Authors: | Mikirtumov, V. | Deposition date: | 2025-07-22 |
|
PDBID: | 9s2v | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-22 |
|
PDBID: | 9ppp | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-21 |
|
PDBID: | 9pon | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9poo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9pop | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9poq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9por | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9pos | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9pot | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9pou | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9pov | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9pow | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9pox | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9poz | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9pp0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|
PDBID: | 9pp1 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-21 |
|