| PDBID: | 9s1c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9s1i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Dihydroorotate Dehydrogenase in complex with arzanol | | Authors: | Alberti, M., Miggiano, R. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9s1h | | Status: | HPUB -- hold until publication | | Title: | Apo-state RyR1 with ACP in the native membrane | | Authors: | Mikirtumov, V. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9s1j | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase Q280A and L282A variant in complex with Fe and ACV under anaerobic conditions. | | Authors: | Jabbary, M., Rabe, P., Schofield, C.J. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9s1g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9s1k | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase S281A variant in complex with Fe and ACV under anaerobic conditions. | | Authors: | Jabbary, M., Rabe, P., Schofield, C.J. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9s1n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DNPH1 bound by compound x (''0812) | | Authors: | Collie, G.W. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9s1o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DNPH1 bound by compound x (''3336). | | Authors: | Collie, G.W. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9pmf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9pmj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-07-17 | | Release date: | 2026-07-17 |
|
| PDBID: | 9pme | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystallographic structure of MazF-E24A toxin bound to SamF | | Authors: | Pizzolato-Cezar, L.R., Nascimento, A.F.Z., Machini, M.T., Salinas, R.K. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9pmi | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of a bifunctional ulvan active enzymes | | Authors: | Mihalynuk, L., Boraston, A.B. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9pmc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9pmd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9pmg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [22-7B TG] 22 bp tensegrity triangle that propagates via blunt-end stacking with T stacking on G at the interface | | Authors: | Horvath, A., Woloszyn, K., Vecchioni, S., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9pmh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | [22-7B AG] 22 bp tensegrity triangle that propagates via blunt-end stacking with A stacking on G at the interface | | Authors: | Horvath, A., Woloszyn, K., Vecchioni, S., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9pmk | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10 | | Authors: | Liu, L., Sun, P., Li, S., Zheng, Q., Xia, N. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of RSV pre-F (strain A2) in complex with Fab 3G12 | | Authors: | Liu, L., Sun, P., Li, S., Zheng, Q., Xia, N. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vwk | | Status: | HPUB -- hold until publication | | Title: | The solution structure of Escherichia coli IscU(G64V) | | Authors: | Na, J., Jeong, M., Ko, Y., Kim, E., Kim, J. | | Deposition date: | 2025-07-17 | | Sequence: | >Entity 1
MAYSEKVIDHYENPRNVGSFDNNDENVGSGMVGAPACGDVMKLQIKVNDEGIIEDARFKTYGCVSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPVKIHCSILAEDAIKAAIADYKSKREAK
|
|
