| PDBID: | 9p7q | | Status: | HPUB -- hold until publication | | Title: | 273K human S-adenosylmethionine decarboxylase | | Authors: | Patel, J.R., Bonzon, T.J., Bahkt, T., Fagbohun, O.O., Clinger, J.A. | | Deposition date: | 2025-06-21 | | Sequence: | >Entity 1
MHHHHHHENLYFQGEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
>Entity 2
(PYR)SMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS
|
|
| PDBID: | 9p7r | | Status: | HPUB -- hold until publication | | Title: | In situ structure of the sheathed FlaB flagellar filament in Vibrio cholerae | | Authors: | Wangbiao, G., Rajeev, K. | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9p7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vju | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9vjq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9ror | | Status: | HPUB -- hold until publication | | Title: | Assembly intermediate of human mitochondrial ribosome small subunit bound to METTL15 and RBFA (Outward conformation) (State M3) | | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | | Deposition date: | 2025-06-21 |
|
| PDBID: | 9p6t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human immunogloblin M-Fc hexamer | | Authors: | Lyu, M., Stadtmueller, B.M. | | Deposition date: | 2025-06-20 |
|
| PDBID: | 9p6u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-20 |
|
| PDBID: | 9p6v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-20 |
|
| PDBID: | 9p70 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-20 |
|
| PDBID: | 9p6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-20 |
|
| PDBID: | 9p7m | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-06-20 | | Release date: | 2026-06-20 |
|
| PDBID: | 9p7p | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-06-20 | | Release date: | 2026-06-20 |
|
| PDBID: | 9p77 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Bovine Trypsin Complexed with Mellitic Acid at Room Temperature | | Authors: | McPherson, A., McPherson, A. | | Deposition date: | 2025-06-20 |
|
| PDBID: | 9p7b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Structure of Bovine Trypsin Complexed With Mellitic Acid at 173 Degrees | | Authors: | McPherson, A. | | Deposition date: | 2025-06-20 |
|
