| PDBID: | 9pg4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pgf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | In situ structure of the human mitoribosome in the P state | | Authors: | Wang, S., Xiong, Y., Zhang, Y. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9pge | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-07-07 | | Release date: | 2026-07-07 |
|
| PDBID: | 9vrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrv | | Status: | HPUB -- hold until publication | | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 1.41 angstrom resolution | | Authors: | Brito, J.A., Orr, C.M., Wagner, A., Goswami, A. | | Deposition date: | 2025-07-07 | | Sequence: | >Entity 1
MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
| PDBID: | 9vrq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrn | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of endo-beta-1,4-mannanase R318K mutant | | Authors: | Hirano, Y., Naka, Y., Ueda, M., Tamada, T. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vro | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of endo-beta-1,4-mannanase R318A mutant | | Authors: | Hirano, Y., Naka, Y., Ueda, M., Tamada, T. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrp | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of endo-beta-1,4-mannanase D316N mutant | | Authors: | Hirano, Y., Naka, Y., Ueda, M., Tamada, T. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vru | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vry | | Status: | HPUB -- hold until publication | | Title: | Carbonyl reductase SxPR mutant-Q158AM198A | | Authors: | Zhen, M., Tingting, Y. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rv3 | | Status: | HPUB -- hold until publication | | Title: | Structure of nermertea worm Lineus viridis nemertide peptide toxin | | Authors: | Laborde, Q., Gunasekera, S. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rva | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rv2 | | Status: | HPUB -- hold until publication | | Title: | HSV1 UL12-ICP8 recombinase complex with DNA | | Authors: | Patra, S., Czarnocki-Cieciura, M., Nowotny, M., Figiel, M. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rv8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rv9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rv4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rvd | | Status: | HPUB -- hold until publication | | Title: | In situ 3D ED/MicroED nanovolume structure of Magnaporthe grisea Woronin Body Major protein crystallized in cellulo | | Authors: | Polovinkin, V., Redecke, L. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rvb | | Status: | HPUB -- hold until publication | | Title: | In situ 3D ED/MicroED microvolume structure of Magnaporthe grisea Woronin Body Major protein crystallized in cellulo | | Authors: | Polovinkin, V., Redecke, L. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rvc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | staphylococcus aureus 70S initiation complex with natural mRNA | | Authors: | Bahena, R., Klaholz, B., Marzi, S. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rv6 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | 5 micrometer HEWL crystals solved at room-temperature using fixed-target serial crystallography. | | Authors: | Mason, T.J., Carrillo, M., Beale, J.H., Padeste, C. | | Deposition date: | 2025-07-07 |
|
