| PDBID: | 9b9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v51 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP10 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40792 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v58 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound heparan sulfate 12mer | | Authors: | Pedersen, L.C., Xu, D., Krahn, J.M. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9ba2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the binary complex of DCAF1 and WDR5 | | Authors: | Mabanglo, M.F., Vedadi, M., Al-awar, R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5p | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the C-terminal domain of the VZV gE ectodomain in complex with the Fab of human antibody 5A2 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MAP4K4 in complex with an inhibitor | | Authors: | Greasley, S.E., Diehl, W. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5s | | Status: | HPUB -- hold until publication | | Title: | VZV glycoprotein E C-terminal domain (cleaved) in complex with human Fab 5A2 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9ba6 | | Status: | HPUB -- hold until publication | | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the apo form | | Authors: | Lee, M., Smith, A.T. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Vibrio cholerae N150T NFeoB variant with a single GDP molecule bound | | Authors: | Lee, M., Smith, A.T. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 7gaq | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z755044716 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9baa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5u | | Status: | HPUB -- hold until publication | | Title: | Human SIRT3 bound to p53-AMC peptide and Honokiol | | Authors: | Chakrabarti, R., Ghosh, A., Guan, X., Upadhyay, A., Dumpati, R.K., Munshi, S., Roy, S., Chall, S., Rahnamoun, A., Reverdy, C., Errasti, G., Delacroix, T. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
>Entity 2
QPK(FDL)
|
|
| PDBID: | 7gar | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z820676436 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9baw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8v65 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 7gas | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z952016136 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 8v66 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 7gau | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition of ground-state model of MAP1LC3B | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-11 |
|
| PDBID: | 9bay | | Status: | HPUB -- hold until publication | | Title: | Single full-chain subunit of the Vpb4Aa2 Pore Complex. | | Authors: | Wirawan, R., Spicer, B.A., Bayly-Jones, C.J., Lupton, C., Venugopal, H., Berry, C., Dunstone, M. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8v68 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 9baq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
