| PDBID: | 8v73 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 9 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v74 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 10 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v8r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Reactive Enamine Deaminase A (RidA) Homolog from an Opportunistic Pathogen, Streptococcus sanguinis. | | Authors: | Thomas, L.M., Rajan, R., Somalinga, V., Benedict, A., Aquino, A. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 9ban | | Status: | HPUB -- hold until publication | | Title: | The Anti-Mullerian Hormone prodomain in complex with the growth factor and 6E11 Fab in C1 symmetry | | Authors: | Howard, J.A., Thompson, T.B. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8v8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-05 |
|
| PDBID: | 9bal | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8uf3 | | Status: | HPUB -- hold until publication | | Title: | Structure of cytochrome c4 from Neisseria gonorrhoeae | | Authors: | Zhong, F., Ragusa, M.J., Pletneva, E.V. | | Deposition date: | 2023-10-03 |
|
| PDBID: | 9bai | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GDP-bound human K-RAS in a covalent complex with aryl sulfonyl fluoride compounds. | | Authors: | Landgraf, A.D., Brenner, R.J., Ghozayel, M.K., Bum-Erdene, K., Gonzalez-Gutierrez, G., Meroueh, S. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8tv5 | | Status: | HPUB -- hold until publication | | Title: | Structure of the EphA2 LBDCRD bound to FabS1CE_L1 in a 2:1 (EphA2 to Fab) ratio | | Authors: | Singer, A.U., Bruce, H.A., Blazer, L., Adams, J.J., Sicheri, F., Sidhu, S.S. | | Deposition date: | 2023-08-17 |
|
| PDBID: | 9bfg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8uiy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 9bfi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8uiz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 9bbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-06 |
|
| PDBID: | 9bc0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-07 |
|
| PDBID: | 8tvd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-18 |
|
| PDBID: | 8u3p | | Status: | HPUB -- hold until publication | | Title: | 1.79 Angstrom resolution crystal structure of KatG from Mycobacterium tuberculosis with an MYW cofactor after heat incubation for 60 minutes | | Authors: | Liu, A., Li, J., Ran, D. | | Deposition date: | 2023-09-08 |
|
| PDBID: | 9b6o | | Status: | HPUB -- hold until publication | | Title: | Fab1-2 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9bdg | | Status: | HPUB -- hold until publication | | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85647 | | Authors: | Ferreira Ramos, A.S., Bajic, G. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8u3s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-08 |
|
| PDBID: | 9bda | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 8tij | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 9be3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8tii | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 in nanodisc | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 9bio | | Status: | HPUB -- hold until publication | | Title: | Structure of VRC44.01 Fab in complex with 3BNC117-purified C1080.c3 RnS SOSIP.664 HIV-1 Env trimer | | Authors: | Gorman, J., Kwong, P.D. | | Deposition date: | 2024-04-23 |
|
