| PDBID: | 8s6p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8s6q | | Status: | HPUB -- hold until publication | | Title: | RosC | | Authors: | Ermler, U., Warkentin, E., Demmer, U., Mack, M. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8s6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8s6s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8zos | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of pyraclostrobin-bound porcine bc1 complex | | Authors: | Wang, Y.X., Sun, J.Y., Li, Z.W., Cui, G.R., Yang, G.F. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8s6n | | Status: | HPUB -- hold until publication | | Title: | Structure of MLLE3 in complex with PAMPL1 | | Authors: | Devan, S., Shanmugasundaram, S., Muentjes, K., Smits, S.H., Altegoer, F., Feldbruegge, M. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8zow | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Metyltetraprole-bound porcine bc1 complex | | Authors: | Wang, Y.X., Sun, J.Y., Cui, G.R., Yang, G.F. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8s72 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of neutralizing Fab Eq4.Dp46-3D from equine antivenom bound to a consensus short chain three finger alpha-neurotoxin. | | Authors: | Ayres, F., Wibmer, C.K. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8zp7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8s6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8zp0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of YF23694-bound porcine bc1 complex | | Authors: | Wang, Y.X., Sun, J.Y., Cui, G.R., Yang, G.F. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8s6y | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of TEAD1 with OPN-9652 | | Authors: | Aplin, A.E. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8zp6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Epoxide hydrolase MdEH (Mycobacterium dioxanotrophicus) | | Authors: | Zhou, Y., Lan, D.M., Wang, Y.H. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8s71 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8zpc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8s74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zpp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s75 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC FL412 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zpe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s7e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zpf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s78 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zpg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s76 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF67 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
