PDBID: | 8rz9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8zk3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8rzp | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8s0a | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s09 | Status: | HPUB -- hold until publication | Title: | H. sapiens MCM2-7 double hexamer bound to double stranded DNA | Authors: | Greiwe, J.F., Weissmann, F., Diffley, J.F.X., Costa, A. | Deposition date: | 2024-02-13 |
|
PDBID: | 8s0b | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s0c | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzs | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8zk1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8rzt | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8zk4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8s08 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8zjw | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8rzx | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s0e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s0d | Status: | HPUB -- hold until publication | Title: | H. sapiens MCM bound to double stranded DNA and ORC1-6 | Authors: | Greiwe, J.F., Weissmann, F., Diffley, J.F.X., Costa, A. | Deposition date: | 2024-02-13 |
|
PDBID: | 8s02 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 | Sequence: | >Entity 1 MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAF(CRO)NRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLP
>Entity 2 MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQSGLEVLFQ
|
|
PDBID: | 8s0z | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-14 |
|
PDBID: | 8s10 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-14 |
|
PDBID: | 8s11 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-14 |
|
PDBID: | 8zjx | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8s0x | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-14 |
|
PDBID: | 8s0w | Status: | HPUB -- hold until publication | Title: | MSOX movie series dataset 1 (0.57 MGy) for as isolated BrJNiR (Cu containing nitrite reductase (NirK) from Bradyrhizobium japonicum USDA110) at pH 8. | Authors: | Rose, S.L., Ferroni, F.M., Horrell, S., Brondino, C.D., Eady, R.R., Jaho, S., Hough, M.A., Owen, A.L., Antonyuk, S.V., Hasnain, S.S. | Deposition date: | 2024-02-14 |
|
PDBID: | 8zjy | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|