PDBID: | 8rgj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rgf | Status: | HPUB -- hold until publication | Title: | Arginase 2 in complex with inhibitor | Authors: | Petersen, J. | Deposition date: | 2023-12-13 |
|
PDBID: | 8ynx | Status: | HPUB -- hold until publication | Title: | Crystal structure of Cag3-CagT complex from Helicobacter pylori | Authors: | Mok, C.Y., Au, S.W.N. | Deposition date: | 2024-03-12 |
|
PDBID: | 8rgv | Status: | HPUB -- hold until publication | Title: | Myo-inositol-1-phosphate synthase from Thermochaetoides thermophila in complex with NAD | Authors: | Traeger, T.K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L. | Deposition date: | 2023-12-14 |
|
PDBID: | 8r0s | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-31 |
|
PDBID: | 8ynz | Status: | HPUB -- hold until publication | Title: | The structure of EfpA_BRD-8000.3 complex | Authors: | Li, D.L., Sun, J.Q. | Deposition date: | 2024-03-12 |
|
PDBID: | 8yo0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-12 |
|
PDBID: | 8rgx | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8rh4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8yoc | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 8rhd | Status: | HPUB -- hold until publication | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | Deposition date: | 2023-12-15 |
|
PDBID: | 8yoh | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 8rhm | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 | Sequence: | >Entity 1 GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
PDBID: | 8yol | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 8yom | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 8rh7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8yok | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 8rh8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8yob | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 8rha | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8yog | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 8rh9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 9fy4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Heme-Oxygenase mutant I143K from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | Deposition date: | 2024-07-02 |
|
PDBID: | 8yoe | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 8rhg | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|