| PDBID: | 8ygl | | Status: | HPUB -- hold until publication | | Title: | Rhodobacter blasticus RC-LH1 monomer | | Authors: | Liu, L.N., Zhang, Y.Z., Wang, P., Christianson, B.M., Ugurlar, D. | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9ffq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8qr9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8ygd | | Status: | HPUB -- hold until publication | | Title: | Rhodobacter blasticus RC-LH1 dimer | | Authors: | Liu, L.N., Zhang, Y.Z., Wang, P., Christianson, B.M., Ugurlar, D. | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9ffr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8qra | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8yg3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9ffs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8qrb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8yg4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9fft | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8qrc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8yg5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8qrp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8ygb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9f82 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-06 |
|
| PDBID: | 8qrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qru | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8yg9 | | Status: | HPUB -- hold until publication | | Title: | pro-RNA-DNA complex 60 | | Authors: | Li, Z. | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8qrv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8yg6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9ffj | | Status: | HPUB -- hold until publication | | Title: | Artificial metalloenzyme with a nickel-based 1,10-phenanthroline cofactor and streptavidin N49M-S112V mutant | | Authors: | Lau, K., Wang, W., Pojer, F., Larabi, A. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yg1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8qrj | | Status: | HPUB -- hold until publication | | Title: | LCC-ICCG PETase mutant H218Y | | Authors: | Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L. | | Deposition date: | 2023-10-09 | | Sequence: | >Entity 1
MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
|
|
| PDBID: | 8yga | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
