PDBID: | 8xqg | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8xqh | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8xqj | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8xr1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 9ct3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 8xqe | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8xr0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of AtHPPD-YH21618 complex | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | Deposition date: | 2024-01-05 |
|
PDBID: | 8xr7 | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xr8 | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrc | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 9ct5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 8xrd | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrb | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xra | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xr9 | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrl | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrm | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrj | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 9ct6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-24 |
|
PDBID: | 8xrk | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xs2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 | Sequence: | >Entity 1 MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2 MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
PDBID: | 8xs1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrs | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 9ctj | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-25 |
|
PDBID: | 8xsq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|