| PDBID: | 8vja | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of tail of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8vjh | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of tail-tip of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8vks | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8vll | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlz | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of human S-OPA1 assembled on lipid membrane containing brominated cardiolipin in membrane-adjacent state | | Authors: | Zuccaro, K.E., Aydin, H. | | Deposition date: | 2024-01-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8vlt | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of glycan-targeting antibody 2526 Fab bound to Mannose | | Authors: | Lindenberger, J., Acharya, P. | | Deposition date: | 2024-01-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8vm4 | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of human S-OPA1 assembled on lipid membrane containing brominated cardiolipin in membrane-adjacent state | | Authors: | Zuccaro, K.E., Aydin, H. | | Deposition date: | 2024-01-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 9bvw | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 main protease bound to inhibitor SR-B-103 | | Authors: | Liu, W.R., Blankenship, L.R. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 9bvx | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 main protease bound to inhibitor YR-C-155 | | Authors: | Liu, W.R., Blankenship, L.R. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 9bvz | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 main protease bound to inhibitor AR-A-135 | | Authors: | Liu, W.R., Blankenship, L.R. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 8v9e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-08 | | Release date: | 2024-12-08 |
|
| PDBID: | 9byn | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of amyloid fibril extracted from nerve of a variant ATTR V30M amyloidosis patient | | Authors: | Nguyen, A.B., Afrin, S., Yakubovska, A., Saelices, L. | | Deposition date: | 2024-05-23 | | Release date: | 2025-05-23 |
|
| PDBID: | 9bzc | | Status: | HOLD -- hold until a certain date | | Title: | Cocrystal structure of Clostridium beijerinckii ZTP riboswitch with ZMP and Cs | | Authors: | Jones, C.J., Ferre D''Amare, A.R. | | Deposition date: | 2024-05-24 | | Release date: | 2024-11-24 |
|
| PDBID: | 9bz1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-24 | | Release date: | 2024-11-24 |
|
| PDBID: | 9bzs | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTR V30M amyloidosis patient | | Authors: | Nguyen, A.B., Afrin, S., Yakubovska, A., Saelices, L. | | Deposition date: | 2024-05-24 | | Release date: | 2025-05-24 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 9c1a | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-28 | | Release date: | 2025-05-28 |
|
| PDBID: | 9c1b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-28 | | Release date: | 2025-05-28 |
|
| PDBID: | 9c1r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-29 | | Release date: | 2025-05-29 |
|
| PDBID: | 9c1d | | Status: | HOLD -- hold until a certain date | | Title: | Mycobaterium tuberculosis Pks13 acyltransferase incubated with DMSO | | Authors: | Tang, S., Sacchettini, J.C., TB Structural Genomics Consortium (TBSGC) | | Deposition date: | 2024-05-29 |
|
| PDBID: | 9c39 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-31 | | Release date: | 2025-05-31 |
|
| PDBID: | 9c3b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-31 | | Release date: | 2025-05-31 |
|
| PDBID: | 8w29 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-20 | | Release date: | 2025-02-20 |
|
| PDBID: | 8w2a | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-20 | | Release date: | 2025-02-20 |
|
| PDBID: | 8w2b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-20 | | Release date: | 2025-02-20 |
|
