| PDBID: | 9fp0 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-12 | | Release date: | 2025-06-12 |
|
| PDBID: | 8z47 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8z48 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8z4c | | Status: | HOLD -- hold until a certain date | | Title: | The Fab fragment of anti-Fibrin monoclonal antibody 59D8 | | Authors: | Zhang, J., Sun, C. | | Deposition date: | 2024-04-17 | | Release date: | 2025-04-17 |
|
| PDBID: | 8qmc | | Status: | HOLD -- hold until a certain date | | Title: | High resolution structure of the Streptococcus pneumoniae topoisomerase IV-complex with the V-site 18mer dsDNA and novel fluoroquinolone Delafloxacin | | Authors: | Najmudin, S., Pan, X.S., Wang, B., Chayen, N.E., Fisher, L.M., Sanderson, M.R. | | Deposition date: | 2023-09-21 | | Release date: | 2024-09-21 |
|
| PDBID: | 9fpc | | Status: | HOLD -- hold until a certain date | | Title: | Architectural insights into the corrin and metal binding sites of CobN cobaltochelatase | | Authors: | Pickersgill, R.W. | | Deposition date: | 2024-06-13 | | Release date: | 2024-12-13 | | Sequence: | >Entity 1
DSRAVPTPAAWELGKKSAELLITRYTQDHGEWPTSFGLTAWGTSNMRTGGDDIAQALALIGVQPVWDMASRRVTGYEIVPPAKLARPRVDVTLRISGFFRDAFPEQIALFDKAVRAVGALDEDVEDNPIAARMKAEQARLVAGGADPQTAERRAGYRVFGSKPGAYGAGLQALIDENGWAGRNDLAEAWLVWGGYAYGAGEEGQAERGLLEERLRSVQAVVQNQDNREHDLLDSDDYYQFEGGMAATVESLTGAMPSVYHNDHSRPEKPVIRALEEELSRVVRGRAANPKWIAGVMRHGYKGAAEIAATVDYLFAFAATTGKVGNHHFEAVYQAYIADRAVHDFMAEKNPAALAETAAKLNEAIERGFWTPRSNSARFELENLS
|
|
| PDBID: | 9fqq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-17 | | Release date: | 2025-06-17 |
|
| PDBID: | 9fqm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-17 | | Release date: | 2025-06-17 |
|
| PDBID: | 8z6b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-18 | | Release date: | 2025-04-18 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z7c | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 9fsd | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of complement-inhibiting protein ChiA of Borrelia recurrentis | | Authors: | Fritz-Wolf, K., Rahlfs, S., Przyborski, J.M., Stumpf, M., Roettgerding, F., Kraiczy, P. | | Deposition date: | 2024-06-20 | | Release date: | 2025-06-20 |
|
| PDBID: | 8z7d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8qsr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-11 | | Release date: | 2024-10-11 |
|
| PDBID: | 8z7t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8qst | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-11 | | Release date: | 2024-10-11 |
|
| PDBID: | 8z7u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 9fsn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-21 | | Release date: | 2025-06-21 |
|
| PDBID: | 8z7v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 9fsw | | Status: | HOLD -- hold until a certain date | | Title: | ClpP from Staphylococcus epidermidis with glycerol in some of the catalytic sites. | | Authors: | Alves Franca, B., Rohde, H., Betzel, C. | | Deposition date: | 2024-06-22 | | Release date: | 2024-07-20 |
|
| PDBID: | 8z7w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8z7x | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
