| PDBID: | 8v4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4e | | Status: | HPUB -- hold until publication | | Title: | Protein complex | | Authors: | Awad, W., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4d | | Status: | HPUB -- hold until publication | | Title: | Protein complex | | Authors: | Awad, W., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9l | | Status: | HPUB -- hold until publication | | Title: | RPRD1B C-terminal interacting domain bound to a pThr4 CTD peptide | | Authors: | Moreno, R.Y., Zhang, Y.J. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 9b9f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 9b9i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40333 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v4z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP7 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9bad | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9ba1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 8v5l | | Status: | HPUB -- hold until publication | | Title: | Structure of the Varicella Zoster Virus (VZV) gI binding domain of glycoprotein E (gE) in complex with human Fab 1A2 and 1E12 | | Authors: | Seraj, N., Holzapfel, G., Harshbarger, W. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v57 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound cystatin C inhibitor | | Authors: | Pedersen, L.C., Xu, D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5b | | Status: | HPUB -- hold until publication | | Title: | Structure of the oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB_Ec F70A/F108Y in complex with FMN | | Authors: | Sharrock, A.V., Ackerley, D.F., Arcus, V. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v50 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP6 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
