| PDBID: | 9b8s | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA in the nucleotide exchange state | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 8v41 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9b8m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 8v3q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9b8n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor (10-S) | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 8v43 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9b9b | | Status: | HPUB -- hold until publication | | Title: | PHF Tau in dominantly inherited Alzheimer disease | | Authors: | Hoq, M.R., Vago, F.S., Bharath, S.R., Jiang, W. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v3s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9b96 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v3o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9b97 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9b98 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v3i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9b9e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v3j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9b95 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the closed NF449-bound human P2X1 receptor | | Authors: | Felix, M.B., Alisa, G., Hariprasad, V., Jesse, I.M., David, M.T. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v42 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Vaccinia-related Kinase 1 (VRK1) Bound to ACH000400 | | Authors: | Counago, R.M., de Souza, G.P., Azevedo, A., Guimaraes, C., Mascarello, A., Gama, F., Ferreira, M., Arruda, P. | | Deposition date: | 2023-11-28 | | Sequence: | >Entity 1
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
|
|
| PDBID: | 8v4w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Campylobacter concisus Csep1 | | Authors: | Anna, R., Xiaotian, Z. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b99 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
