| PDBID: | 8v0c | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB06 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 9b6o | | Status: | HPUB -- hold until publication | | Title: | Fab1-2 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8v0b | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB05 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 9atb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9b6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8v16 | | Status: | HPUB -- hold until publication | | Title: | Esterase with a monomeric cooperative, hysteresis or allokairy | | Authors: | Guzzo, C.R., Vinces, T.G.C., Visnardi, A.B. | | Deposition date: | 2023-11-19 |
|
| PDBID: | 9b6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8v1a | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine and ATP in two different conformation: 8OG (syn)-ATP (A site) and 8OG (anti)-ATP (E site) | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9b6y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8v1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9b6u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8v1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 8v1c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I3 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9b72 | | Status: | HPUB -- hold until publication | | Title: | Rec2 Domain from G. stearothermophilus Cas9 | | Authors: | D''Ordine, A.M., Belato, H.B., Lisi, G.P., Jogl, G. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8v1d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I25 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9b73 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the desensitised ATP-bound human P2X1 receptor | | Authors: | Felix, M.B., Alisa, G., Hariprasad, V., Jesse, I.M., David, M.T. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8v1w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9b74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8v22 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9b75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b76 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7d | | Status: | HPUB -- hold until publication | | Title: | Structure of ThsB-Tad3 complex | | Authors: | Hobbs, S.J., Tan, J.M.J., Yirmiya, E., Sorek, R., Kranzusch, P.J. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8v1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
