| PDBID: | 8rsj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8yxt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rsk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8yxq | | Status: | HPUB -- hold until publication | | Title: | NADPH and 1-benzyl-4-methylpiperidin-3-one complex structure of Imine Reductase wild type from Pochonia chlamydosporia 170 | | Authors: | Shi, M., Zheng, G. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rsl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8yxc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rsm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8yx2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rsn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8yx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rs8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8yx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rsx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8yx5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rsz | | Status: | HPUB -- hold until publication | | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Schulz, E.C., Wilmanns, M. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8yxe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8yxf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8yxg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rso | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8yxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rsp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8yxd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rsq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8yxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8rss | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 | | Sequence: | >Entity 1
MEELTYRLFMVATVGMLAGTVFLLASSREVKPEHRRGVYISALVCGIAWYHYQKMGASWESGSYDTGLRYVDWVLTVPLMFVEVLAVTRKGAAYNEAVRNWGIAATVMIGAGYYGETSAAGSNEYWTGFVIAMATYVWLMRNLQAEGEGLKGDQAVAFENIKNLILVGWIIYPLGYIAPVVGDFDAIREVLYTIADIIN(LYR)VGLGVLVLQMARVQSGEKVS
|
|
