| PDBID: | 8r6v | | Status: | HPUB -- hold until publication | | Title: | The complex of glycogen phosphorylase with EGCG (epigallocatechin gallate) and caffeine. | | Authors: | Alexopoulos, S., Papakostopoulou, S., Koulas, M.S., Leonidas, D.D., Skamnaki, V. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r75 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 1 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r73 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 1 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8yi7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
LSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH
>Entity 2
AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
>Entity 3
KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEHHHHHH
>Entity 4
CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPHHHHHH
|
|
| PDBID: | 8r71 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HAdp4 collected at 1.22 A | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8yi9 | | Status: | HPUB -- hold until publication | | Title: | human PRPS2 isoform2 | | Authors: | Liu, J.L., Lu, G.M. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8r72 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HA dp4 collected at 1.33 A | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8yih | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8r70 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HA dp4 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8yio | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in azoxystrobin-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8r6z | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 2 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8yij | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8r6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8yil | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF24228-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yje | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9fkf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-03 |
|
| PDBID: | 8yj9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9fkc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-03 |
|
| PDBID: | 8r78 | | Status: | HPUB -- hold until publication | | Title: | Ficin D cystein protease | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8yjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8r7h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8yj4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8yjh | | Status: | HPUB -- hold until publication | | Title: | endogenous state A PCNA-DNA-FEN1 complex | | Authors: | Tian, Y., Gao, N. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9fkp | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Betaglycan Orphan Domain (zfBGo) in complex with TGF-B3 and extracellular domains of TGFBRI and TGFBRII | | Authors: | Wieteska, L., Coleman, J.A., Hinck, A.P. | | Deposition date: | 2024-06-03 |
|
| PDBID: | 8r7c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
