| PDBID: | 8zr6 | | Status: | HPUB -- hold until publication | | Title: | Arabidopsis Carboxyl esterase CXE15 E271Q mutant | | Authors: | Arold, S.T., Hameed, U.F.S. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 9g5e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8zrf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-04 |
|
| PDBID: | 9g58 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8zrg | | Status: | HPUB -- hold until publication | | Title: | Arabidopsis Carboxylesterase CXE15 C14S mutant | | Authors: | Arold, S.T., Hameed, U.F.S. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 9g51 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LmrR with V15 replaced by unnatural amino acid 4-mercaptophenylalanine, apo | | Authors: | Thunnissen, A.M.W.H., Aalbers, F.S., Veen, M.J., Rozeboom, H.J., Roelfes, G. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9g4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8zrm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-04 |
|
| PDBID: | 9g52 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LmrR with V15 replaced by unnatural amino acid 4-mercaptophenylalanine, Au(I) bound | | Authors: | Thunnissen, A.M.W.H., Aalbers, F.S., Veen, M.J., Rozeboom, H.J., Roelfes, G. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9g59 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9g4v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8qy7 | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD apo form | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 9g4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8qyc | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD in complex with ATP-gamma-S | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 9g4p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8qyd | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 9g4r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8qz5 | | Status: | HPUB -- hold until publication | | Title: | Alpha-1-antitrypsin (Tyr244Phe) in the native conformation | | Authors: | Aldobiyan, I., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-10-26 | | Sequence: | >Entity 1
MRGSHHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH(OCS)KKLSSWVLLMKFLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
|
|
| PDBID: | 9g4q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9g4u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human METTL3-METTL14 in complex with small molecule inhibitor Compound 37 | | Authors: | Dutheuil, G., Oukoloff, K. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8qzb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 | | Release date: | 2025-04-26 |
|
| PDBID: | 9g4w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human METTL3-METTL14 in complex with small molecule inhibitor Compound 69 | | Authors: | Dutheuil, G., Oukoloff, K. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8qza | | Status: | HPUB -- hold until publication | | Title: | D-2-hydroxyacid dehydrogenase (D2-HDH) from Haloferax mediterranei apo-enzyme (2.25 A resolution) | | Authors: | Baker, P.J., Barrett, J.R., Dakhil, A.A.A.B., Domenech, J., Bisson, C., Pramanpol, N., Sedelnikova, S.E., Ferrer, J., Rice, D.W. | | Deposition date: | 2023-10-26 | | Release date: | 2025-04-26 |
|
| PDBID: | 8qz6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
