| PDBID: | 8qun | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 2-((5-cyano-4-hydroxy-6-(p-tolyl)pyrimidin-2-yl)thio)-N-(4-sulfamoylphenyl)acetamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8zqw | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of PDE4D with isoaurostatin derivatives 2-9 | | Authors: | Huang, Y.-Y., Luo, H.-B. | | Deposition date: | 2024-06-03 |
|
| PDBID: | 9g49 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8qup | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8zr4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-03 |
|
| PDBID: | 9g4d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM reconstruction of the full-length H209N mutant E. coli transmembrane formate transporter FocA | | Authors: | Tueting, C., Janson, K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9g4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8qv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 | | Release date: | 2025-04-17 |
|
| PDBID: | 9g4h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8qv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 | | Release date: | 2025-04-17 |
|
| PDBID: | 9g4m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of monoacylglycerol lipase with BODIPY labeled probe | | Authors: | Guberman, M., Hentsch, A., Radetzki, S., Kaushik, S., Huizenga, M., van der Stelt, M., Paul, J., Schippers, M., Hochstrasser, R., von Kries, J.P., Blaising, J., Lipstein, N., Nazare, M., Grether, U., Kuhn, B., Walter, A., Benz, J. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8zr8 | | Status: | HPUB -- hold until publication | | Title: | The Crystal Structure of Nudix Hydrolase from Bacillus methanolicus C1 | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 9g4j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8qvn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cx26 from Gallus Gallus in bicarbonate buffer | | Authors: | Brotherton, D.H., Cameron, A.D. | | Deposition date: | 2023-10-18 | | Sequence: | >Entity 1
MDWGTLQAVLGGVNKHSTSIGKIWLTVLFIFRIMILVVAAERVWGDEQQDFVCNTLQPGCRNVCYDHFFPISHIRLWALQLIFVSTPALLVAMHVAYTRHERKRRFRSGDKINIEELKNEKIHIRGPLWWTYTCSIFFRIVFEAVFMYVFYYMYDGYQMPRLVKCDAWPCPNVVDCFVSRPTEKTTFTIFMLAVSGICMMLNLAELCYLVIKVCLKDSGKTTVLK
|
|
| PDBID: | 8zre | | Status: | HPUB -- hold until publication | | Title: | HBcAg-D4 Fab complex | | Authors: | Liu, C., Yan, H., Ju, B. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 9g4k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8qvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 9g4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8qw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8zr9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-04 |
|
| PDBID: | 8qw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8zr7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Skd3 | | Authors: | Lee, S., Lee, C. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 9g4t | | Status: | HPUB -- hold until publication | | Title: | Beta carbonic anhydrase CsoSCA from the Halothiobacillus neapolitanus alpha-carboxysome | | Authors: | Ng, P.C., Marles-Wright, J., Basle, A., Liu, L. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 8qwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-23 |
|
| PDBID: | 8zrn | | Status: | HPUB -- hold until publication | | Title: | Structure of abt | | Authors: | Su, J., Yu, Z., Zhao, Y. | | Deposition date: | 2024-06-04 |
|
