| PDBID: | 9eq6 | | Status: | HPUB -- hold until publication | | Title: | Cachd1 and FZD5 complex | | Authors: | Zhao, Y., Ren, J., Jones, E.Y. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8kel | | Status: | HPUB -- hold until publication | | Title: | Structure of DexA reveal the novel Mechanism of DNA catalysis | | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | | Deposition date: | 2023-08-12 |
|
| PDBID: | 8q6l | | Status: | HPUB -- hold until publication | | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8xso | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9eqs | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 100uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8x8u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of F.occidentalis GABARAP | | Authors: | Zhang, S.Q., Luo, X., Wu, Z.L., Zhao, K.H., Li, X.Y. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9eqq | | Status: | HPUB -- hold until publication | | Title: | Uhgb_MS mannoside synthase from an unknown human gut bacterium in complex with Mannose | | Authors: | Cioci, G., Ladeveze, S., Potocki-Veronese, G. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ker | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 XBB Variant Spike protein complexed with broadly neutralizing antibody PW5-535 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8kep | | Status: | HPUB -- hold until publication | | Title: | The local refined map of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9f24 | | Status: | HPUB -- hold until publication | | Title: | DARPin eGFP complex DP4 (2G71) | | Authors: | Mittl, P.R., Winkelvoss, D. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8keo | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9f2c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8keq | | Status: | HPUB -- hold until publication | | Title: | State 1 of SARS-CoV-2 XBB Variant Spike protein trimer complexed with antibody PW5-5 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8xsh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9erk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8kes | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8xsg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9erz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8kew | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9f2x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 Mpro in complex with RHTCR03 | | Authors: | El kilani, H., Hilgenfeld, R. | | Deposition date: | 2024-04-24 |
|
| PDBID: | 8q6q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8xsn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8q6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 9esd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8xse | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 RBD + IMCAS-123 + IMCAS-72 Fab | | Authors: | Tong, Z., Cui, Y., Xie, Y., Tong, J., Gao, G.F., Qi, J. | | Deposition date: | 2024-01-09 |
|
