PDBID: | 8kdt | Status: | HPUB -- hold until publication | Title: | The local refined map of SARS-CoV Spike protein complexed with antibody PW5-5 | Authors: | Sun, L., Mao, Q., Wang, Y. | Deposition date: | 2023-08-10 |
|
PDBID: | 8xs2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 | Sequence: | >Entity 1 MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2 MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
PDBID: | 9evz | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 8kdv | Status: | HPUB -- hold until publication | Title: | Structure of Oval fibril at 3.5 Angstroms resolution | Authors: | Li, D., Zhang, X., Zhu, P. | Deposition date: | 2023-08-10 |
|
PDBID: | 8xrq | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | Authors: | Liu, C.C., Ju, B., Zhang, Z. | Deposition date: | 2024-01-08 |
|
PDBID: | 9ex5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-05 |
|
PDBID: | 8q67 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 |
|
PDBID: | 8xrr | Status: | HPUB -- hold until publication | Title: | A complex structure of PDGFRA with an inhibitor RH140 | Authors: | Zhu, S.J., Bi, S.Z. | Deposition date: | 2024-01-08 |
|
PDBID: | 8q69 | Status: | HPUB -- hold until publication | Title: | Crystal structure of HsRNMT complexed with inhibitor DDD1060606 | Authors: | Petit, A.P., Fyfe, P.K. | Deposition date: | 2023-08-11 |
|
PDBID: | 8xrz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 9es6 | Status: | HPUB -- hold until publication | Title: | ADP:BeF3-bound human mitochondrial Hsp60 double-ring complex | Authors: | Lopez-Alonso, J.P., Tascon, I., Ubarretxena-Belandia, I., Shkolnisky, Y. | Deposition date: | 2024-03-25 |
|
PDBID: | 8q6d | Status: | HPUB -- hold until publication | Title: | Anaerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with HIF2alpha-CODD peptide (523-542), Fe(II) and 2-oxoglutarate (2OG) | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | Deposition date: | 2023-08-11 |
|
PDBID: | 8q6e | Status: | HPUB -- hold until publication | Title: | Aerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with Fe(III), 2-oxoglutarate (2OG) and HIF2alpha-CODD peptide | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | Deposition date: | 2023-08-11 |
|
PDBID: | 8x8m | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 9f02 | Status: | HPUB -- hold until publication | Title: | HIV-1 envelope glycoprotein (BG505 gp140 SOSIP.664) trimer in complex with three copies of ELC07 broadly neutralizing antibody. | Authors: | Hope, J., Alguel, Y., Nans, A., Cherepanov, P. | Deposition date: | 2024-04-15 |
|
PDBID: | 8ke7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 |
|
PDBID: | 8x8j | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 9f07 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8kek | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 |
|
PDBID: | 8xsp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 9f09 | Status: | HPUB -- hold until publication | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Complex with 2-deoxyribose, 7-Bromo-1H-imidazo[4,5-b]pyridine and 2''-deoxycytidine | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | Deposition date: | 2024-04-15 |
|
PDBID: | 8kej | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 |
|
PDBID: | 9eq2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-20 |
|
PDBID: | 9ept | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Plastid Redox Insensitive 2 from Arabidopsis thaliana | Authors: | Ruedas, R., Vallet, A., Blanvillain, R., Cobessi, D. | Deposition date: | 2024-03-20 |
|
PDBID: | 8ken | Status: | HPUB -- hold until publication | Title: | Structure of DexA reveal the novel mechanism of DNA catalysis | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | Deposition date: | 2023-08-12 |
|