PDBID: | 9f49 | Status: | HOLD -- hold until a certain date | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | Authors: | Pichel, A., van Raaij, M.J. | Deposition date: | 2024-04-26 | Release date: | 2024-06-21 | Sequence: | >Entity 1 KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
PDBID: | 8y2m | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-26 | Release date: | 2025-01-26 |
|
PDBID: | 8y2t | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 3C protease from coxsackievirus B3 | Authors: | Jiang, H.H., Zou, X.F., Zhang, J., Li, J. | Deposition date: | 2024-01-27 | Release date: | 2025-01-27 |
|
PDBID: | 8y2u | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 3C protease from coxsackievirus B4 | Authors: | Jiang, H.H., Lin, C., Zhang, J., Li, J. | Deposition date: | 2024-01-27 | Release date: | 2025-01-27 |
|
PDBID: | 8kdv | Status: | HOLD -- hold until a certain date | Title: | Structure of Oval fibril at 3.5 Angstroms resolution | Authors: | Li, D., Zhang, X., Zhu, P. | Deposition date: | 2023-08-10 | Release date: | 2025-02-26 |
|
PDBID: | 8y35 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of amylomaltase from Corynebacterium glutamicum ATCC 13032 | Authors: | Krusong, K., Chek, M.F., Hakoshima, T. | Deposition date: | 2024-01-28 | Release date: | 2025-01-28 |
|
PDBID: | 8y3a | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of amylomaltase from Corynebacterium glutamicum in complex with acarbose intermediate and glucose | Authors: | Krusong, K., Chek, M.F., Hakoshima, T. | Deposition date: | 2024-01-28 | Release date: | 2025-01-28 |
|
PDBID: | 8keb | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-11 | Release date: | 2025-02-11 |
|
PDBID: | 8ked | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-11 | Release date: | 2025-02-11 |
|
PDBID: | 8ke0 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-11 | Release date: | 2025-02-11 |
|
PDBID: | 8y3b | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of amylomaltase from Corynebacterium glutamicum in complex with maltopentaose | Authors: | Krusong, K., Chek, M.F., Hakoshima, T. | Deposition date: | 2024-01-29 | Release date: | 2025-01-29 |
|
PDBID: | 8keu | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8y4d | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease in complex with Bofutrelvir | Authors: | Zhou, X.L., Wang, W.W., Zhang, J., Li, J. | Deposition date: | 2024-01-30 | Release date: | 2025-01-30 |
|
PDBID: | 8q6r | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-14 | Release date: | 2024-08-14 |
|
PDBID: | 8y4e | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS main protease in complex with Bofutrelvir | Authors: | Lin, C., Wang, W.W., Zhang, J., Li, J. | Deposition date: | 2024-01-30 | Release date: | 2025-01-30 |
|
PDBID: | 8kex | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-14 | Release date: | 2025-02-14 |
|
PDBID: | 8y4f | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of HCoV 229E main protease in complex with Bofutrelvir | Authors: | Zeng, P., Wang, W.W., Zhang, J., Li, J. | Deposition date: | 2024-01-30 | Release date: | 2025-01-30 |
|
PDBID: | 8y4g | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease G15S mutant in complex with Bofutrelvir | Authors: | Zeng, P., Wang, W.W., Zhang, J., Li, J. | Deposition date: | 2024-01-30 | Release date: | 2025-01-30 |
|
PDBID: | 8y4h | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease K90R mutant in complex with Bofutrelvir | Authors: | Guo, L., Wang, W.W., Zhang, J., Li, J. | Deposition date: | 2024-01-30 | Release date: | 2025-01-30 |
|
PDBID: | 8q78 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-15 | Release date: | 2024-08-15 |
|
PDBID: | 8y56 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-31 | Release date: | 2025-01-31 |
|
PDBID: | 9f7e | Status: | HOLD -- hold until a certain date | Title: | CtdA Canavanine tRNA-editing deacetylase from Pseudomonas canavaninivorans | Authors: | Tabagari, N., Mayans, O. | Deposition date: | 2024-05-03 | Release date: | 2025-05-03 |
|
PDBID: | 8kg1 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the cargo cysteine desulfurase from Mycobacterium smegmatis | Authors: | Liu, X., Tang, Y., Liu, Y., Ma, M., Gao, Y. | Deposition date: | 2023-08-17 | Release date: | 2024-11-17 |
|
PDBID: | 8khh | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-21 | Release date: | 2025-02-21 |
|
PDBID: | 8qa7 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-22 | Release date: | 2024-08-22 |
|