| PDBID: | 8jl7 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 8.0 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8xsr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8iky | | Status: | HOLD -- hold until a certain date | | Title: | The Leeuwenhoekiella ORF-less Group IIC intron DEAR6 at apo state | | Authors: | Zhu, H.Z., Liu, J.J.G. | | Deposition date: | 2023-03-01 | | Release date: | 2024-09-01 |
|
| PDBID: | 8xd8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-10 | | Release date: | 2024-12-10 |
|
| PDBID: | 8is1 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a polyketide aromatase/cyclase Abx(+)C from Actinomycetes sp. MA7150 | | Authors: | Luo, S., Chen, X., Jiang, K., Qu, X. | | Deposition date: | 2023-03-20 | | Release date: | 2024-09-20 |
|
| PDBID: | 8ikt | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-03-01 | | Release date: | 2024-09-01 |
|
| PDBID: | 8ikv | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-03-01 | | Release date: | 2024-09-01 |
|
| PDBID: | 9evv | | Status: | HOLD -- hold until a certain date | | Title: | His579Leu variant of L-arabinonate dehydratase co-crystallized with 2-oxobutyrate | | Authors: | Ren, Y., Rouvinen, J., Hakulinen, N. | | Deposition date: | 2024-04-02 | | Release date: | 2025-04-02 |
|
| PDBID: | 8j9u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-05-04 | | Release date: | 2024-10-05 |
|
| PDBID: | 8iur | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a polyketide decarboxylase Abx(+)O from Actinomycetes sp. MA7150 | | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | | Deposition date: | 2023-03-24 | | Release date: | 2024-09-24 |
|
| PDBID: | 8ws8 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wrv | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8jgk | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of mClC-3 with ADP | | Authors: | Wan, Y.Z.Q., Yang, F. | | Deposition date: | 2023-05-21 | | Release date: | 2024-08-28 |
|
| PDBID: | 8wru | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8ibb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-10 | | Release date: | 2024-08-20 |
|
| PDBID: | 8ik6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-28 | | Release date: | 2024-08-31 |
|
| PDBID: | 8wmz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-05 | | Release date: | 2024-10-05 |
|
| PDBID: | 8ikm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-28 | | Release date: | 2024-08-31 |
|
| PDBID: | 8x3l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 9exe | | Status: | HOLD -- hold until a certain date | | Title: | membrane complex from Haemophilus influenzae - conformation A | | Authors: | Castro, D.K.D.V., Delepelaire, P., Biou, V. | | Deposition date: | 2024-04-08 | | Release date: | 2025-04-08 |
|
| PDBID: | 9exp | | Status: | HOLD -- hold until a certain date | | Title: | Wzc-K540M-2YE MgADP C8 | | Authors: | Liu, J.W., Yang, Y., Naismith, J.H. | | Deposition date: | 2024-04-08 | | Release date: | 2025-04-08 |
|
| PDBID: | 9exq | | Status: | HOLD -- hold until a certain date | | Title: | Wzc-K540M-3YE-N711Y MgADP C1 | | Authors: | Liu, J.W., Yang, Y., Naismith, J.H. | | Deposition date: | 2024-04-08 | | Release date: | 2025-04-08 |
|
| PDBID: | 8xtt | | Status: | HOLD -- hold until a certain date | | Title: | Nuclear receptor Nor1 ligand binding domain | | Authors: | Yoo, J.Y., Yoon, H.S. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
| PDBID: | 8xto | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment L18-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
LGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8xtn | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
