Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 12279 results
PDBID:8i9n
Status:AUTH -- processed, waiting for author review and approval
Title:ecCTPS with ATP UTP GTP and DON
Authors:Guo, C.J., Liu, J.L.
Deposition date:2023-02-07
Release date:2024-08-07
PDBID:8ic2
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2023-02-10
Release date:2024-08-10
PDBID:8ic5
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2023-02-10
Release date:2024-08-10
PDBID:8g9g
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2023-02-21
Release date:2024-08-21
PDBID:8g9i
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2023-02-21
Release date:2024-08-21
PDBID:8vxb
Status:HOLD -- hold until a certain date
Title:Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin
Authors:Nalam, P., Cook, P., Smith, B.
Deposition date:2024-02-04
Release date:2025-02-04
Sequence:

>Entity 1


MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
PDBID:8vxo
Status:HOLD -- hold until a certain date
Title:Cryo-EM structure of modified JEV virus E protein dimer
Authors:Galkin, A., Pozharski, E., Li, Y.
Deposition date:2024-02-05
Release date:2025-02-05
PDBID:8ijy
Status:HOLD -- hold until a certain date
Title:Synechococcus elongatus 6-4 photolyase with an 8-HDF as the antenna chromophore and a covalently linked FAD as the catalytic cofactor
Authors:Liu, Y., Xu, L., Zhang, P.
Deposition date:2023-02-28
Release date:2024-08-28
PDBID:8ikn
Status:HOLD -- hold until a certain date
Title:S3.11-T-box in complex with WT Mycobacterium smegmatis isoleucine tRNA
Authors:Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, K., Wei, X.W., Yang, Y., Henkin, T.M., Su, Z.
Deposition date:2023-02-28
Release date:2024-08-28
PDBID:8ikk
Status:HOLD -- hold until a certain date
Title:Mycobacterium smegmatis ileS T-box RNA in complex with its cognate tRNA
Authors:Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, M., Wei, X., Yang, Y., Henkin, T.M., Su, Z.
Deposition date:2023-02-28
Release date:2024-08-28
PDBID:8iki
Status:HOLD -- hold until a certain date
Title:Mycobacterium smegmatis ileS T-box RNA in complex with acc.11-tRNA
Authors:Jia, X., Luo, B., Su, Z.
Deposition date:2023-02-28
Release date:2024-08-28
PDBID:8iko
Status:HOLD -- hold until a certain date
Title:S3.11-T-box in complex with acc.11-tRNA
Authors:Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, M., Wei, X., Yang, Y., Henkin, T.M., Su, Z.
Deposition date:2023-02-28
Release date:2024-08-28
PDBID:8ilo
Status:HOLD -- hold until a certain date
Title:Structure of Monkeypox I7 protease in the apo-form
Authors:Lan, W., You, T., Li, D., Dong, X., Wang, H., Xu, J., Wang, W., Gao, Y., Yang, H.
Deposition date:2023-03-04
Release date:2024-09-04
PDBID:8ilp
Status:HOLD -- hold until a certain date
Title:Structure of Monkeypox I7 protease in the complex with E64D
Authors:Lan, W., You, T., Li, D., Dong, X., Wang, H., Xu, J., Wang, W., Gao, Y., Yang, H.
Deposition date:2023-03-04
Release date:2024-09-04
PDBID:8ipf
Status:HOLD -- hold until a certain date
Title:Crystal structure of a DARPin protein
Authors:Ngo, K.H., Liew, C.W., Heddi, B., Phan, A.T.
Deposition date:2023-03-14
Release date:2024-09-18
PDBID:8ix5
Status:HOLD -- hold until a certain date
Title:X-ray structure of FBB18 from Chlamydomonas reinhardtii.
Authors:Sahashi, Y., Tanaka, H., Shimo-Kon, R., Yamamoto, R., Kurisu, G., Kon, T.
Deposition date:2023-03-31
Release date:2024-09-30
PDBID:8iz3
Status:HOLD -- hold until a certain date
Deposition date:2023-04-06
Release date:2024-10-06
PDBID:8iyy
Status:HOLD -- hold until a certain date
Title:Single excitation and two emissions pH sensor protein(SITE-pHorin)_pH7.0
Authors:Li, S.A., Kang, J.S.
Deposition date:2023-04-06
Release date:2024-10-06
PDBID:8iyz
Status:HOLD -- hold until a certain date
Title:mTurquoise2 S65T
Authors:Kang, J.S., Li, S.A.
Deposition date:2023-04-06
Release date:2024-10-06
PDBID:8iz0
Status:HOLD -- hold until a certain date
Title:mTurquoise2 W66Y
Authors:Li, S.A., Kang, J.S.
Deposition date:2023-04-06
Release date:2024-10-06
PDBID:8iz2
Status:HOLD -- hold until a certain date
Title:Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH8.0
Authors:Kang, J.S., Li, S.A.
Deposition date:2023-04-06
Release date:2024-10-06
PDBID:8iyv
Status:HOLD -- hold until a certain date
Title:Crystal structure of trypsin-famotidine complex at 2.10 Angstroms resolution
Authors:Ahmad, M.S., Kalam, N., Akbar, Z., Rasheed, S., Choudhary, M.I.
Deposition date:2023-04-06
Release date:2024-10-06
PDBID:8izk
Status:HOLD -- hold until a certain date
Deposition date:2023-04-07
Release date:2024-10-07
PDBID:8j47
Status:HOLD -- hold until a certain date
Title:CryoEM Structure of 40-Residue Arctic (E22G) Beta-Amyloid Fibril Derived by Co-Analysis with Solid-State NMR | E22G Abeta40
Authors:Tehrani, M.J., Matsuda, I., Yamagata, A., Matsunaga, T., Sato, M., Toyooka, K., Shirouzu, M., Ishii, Y., Kodama, Y., McElheny, D., Kobayashi, N.
Deposition date:2023-04-19
Release date:2024-10-23
PDBID:8j4n
Status:HOLD -- hold until a certain date
Deposition date:2023-04-20
Release date:2024-10-20

222415

数据于2024-07-10公开中

PDB statisticsPDBj update infoContact PDBjnumon