| PDBID: | 8uxv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uxz | | Status: | HPUB -- hold until publication | | Title: | Structure of E. coli acetyl-CoA carboxylase (local reconstruction of the wide helical tube at 3.31 Angstrom resolution) | | Authors: | Xu, X., Silva de Sousa, A., Boram, T.J., Jiang, W., Lohman, R.J. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 9b4z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8uxy | | Status: | HPUB -- hold until publication | | Title: | Consensus olfactory receptor consOR1 bound to L-menthol and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 9b52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9b53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8uy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9b5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8uy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uya | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9ar6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8uyb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9b62 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8uyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9b60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8uy6 | | Status: | HPUB -- hold until publication | | Title: | Aquaporin Z with ALFA tag and bound to nanobody | | Authors: | Stover, L., Bahramimoghaddam, H., Wang, L., Zhou, M., Laganowsky, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9b61 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8uy5 | | Status: | HPUB -- hold until publication | | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9b67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8uyn | | Status: | HPUB -- hold until publication | | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2023-11-13 | | Sequence: | >Entity 1
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
| PDBID: | 9b68 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8uln | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 9b64 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
