| PDBID: | 9j09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9br2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9bqx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8v1a | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine and ATP in two different conformation: 8OG (syn)-ATP (A site) and 8OG (anti)-ATP (E site) | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9br5 | | Status: | HPUB -- hold until publication | | Title: | IL1RAP-specific Fab | | Authors: | Mallett, T.C., Williams, J.C., Park, M. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9j0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 8v1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9bqk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 peptide GLAPPQHLIRV | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8v1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9j0r | | Status: | HPUB -- hold until publication | | Title: | Structure of pcStar in the green fluorescent state | | Authors: | Zheng, S.P. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 8v1c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I3 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9j0h | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of styrene monooxygenase StyA from Streptomyces vilmorinianum | | Authors: | Wang, L., Zhou, J. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9bqu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 mutant peptide GLAPPQHLFRV | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8v1d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I25 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9j0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 8v1w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9j03 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 8v1v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9j0k | | Status: | HPUB -- hold until publication | | Title: | An agonist(compound 14e)of Thyroid Hormone Receptor B | | Authors: | Yao, B., Li, Y. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 8v22 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9j0j | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Fe/2OG-dependent oxygenase DfmD | | Authors: | Wang, L., Chen, J., Zhou, J. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9bqw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9j02 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 8v1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
