| PDBID: | 8ze3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8tfw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-12 |
|
| PDBID: | 8ze0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8tpx | | Status: | HPUB -- hold until publication | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 3 in complex with antibody fragment 1B2: trans-oriented 1B2 and ACP | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8ze5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8tq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8ze9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8u5x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8u7a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-15 |
|
| PDBID: | 8z83 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-21 |
|
| PDBID: | 8u7f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CIB_12 beta-galactosidase from Cuniculiplasma divulgatum | | Authors: | Stogios, P.J., Skarina, T., Di Leo, R., Yakunin, A., Golyshin, P., Savchenko, A. | | Deposition date: | 2023-09-15 |
|
| PDBID: | 8z8t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8uag | | Status: | HPUB -- hold until publication | | Title: | Sucrose-phosphate synthase-like protein from Leishmania major | | Authors: | Gorman, M.A., Parker, M.W., McConville, M.J. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8z9w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8u9z | | Status: | HPUB -- hold until publication | | Title: | Substrate-bound Cdc48, Class 7 | | Authors: | Cooney, I., Schubert, H.L., Cedeno, K., Lin, H.J.L., Fisher, O.N., Price, J.C., Hill, C.P., Shen, P.S. | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8za2 | | Status: | HPUB -- hold until publication | | Title: | lbADH mutant L195S/V196L with NADP | | Authors: | Xu, W.H., Cen, Y.X., Wu, Q. | | Deposition date: | 2024-04-24 |
|
| PDBID: | 8u1y | | Status: | HPUB -- hold until publication | | Title: | E.coli DsbA in complex with N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-04 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8za3 | | Status: | HPUB -- hold until publication | | Title: | lbADH mutant A144F with NADP | | Authors: | Xu, W.H., Cen, Y.X., Wu, Q. | | Deposition date: | 2024-04-24 |
|
| PDBID: | 8tyf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-25 |
|
| PDBID: | 8za1 | | Status: | HPUB -- hold until publication | | Title: | lbADH mutant E144R with NADP | | Authors: | Xu, W.H., Cen, Y.X., Wu, Q. | | Deposition date: | 2024-04-24 |
|
| PDBID: | 8tyt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-25 |
|
| PDBID: | 8zma | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8s3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8zbv | | Status: | HPUB -- hold until publication | | Title: | alpha-L-fucosidase from Pontiella sulfatireligans F21 | | Authors: | Zhao, P., Bai, L., Wang, S. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8s41 | | Status: | HPUB -- hold until publication | | Title: | The structure of the copia retrotransposon icosahedral capsid (T=9) | | Authors: | Klumpe, S., Beck, F., Briggs, J.A.G., Beck, M., Plitzko, J.M. | | Deposition date: | 2024-02-20 |
|
