PDBID: | 8znm | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-27 |
|
PDBID: | 8s42 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-02-21 |
|
PDBID: | 8znj | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-27 |
|
PDBID: | 8s4l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 | Sequence: | >Entity 1 MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8z3f | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8s4j | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8zo9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-28 |
|
PDBID: | 8s4i | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8zoa | Status: | HPUB -- hold until publication | Title: | Structure of the wild-type PSI-8VCPI supercomplex in Nannochloropsis oceanica | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | Deposition date: | 2024-05-28 |
|
PDBID: | 8zob | Status: | HPUB -- hold until publication | Title: | Structure of the wild-type PSI-5VCPI supercomplex in Nannochloropsis oceanica | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | Deposition date: | 2024-05-28 |
|
PDBID: | 8s4h | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8zoc | Status: | HPUB -- hold until publication | Title: | Structure of the canthaxanthin mutant PSI-9VCPI supercomplex in Nannochloropsis oceanica | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | Deposition date: | 2024-05-28 |
|
PDBID: | 8s4e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8zod | Status: | HPUB -- hold until publication | Title: | Structure of the canthaxanthin mutant PSI-5VCPI supercomplex in Nannochloropsis oceanica | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | Deposition date: | 2024-05-28 |
|
PDBID: | 8s4k | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8zoe | Status: | HPUB -- hold until publication | Title: | Structure of the canthaxanthin mutant PSI-4VCPI supercomplex in Nannochloropsis oceanica | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | Deposition date: | 2024-05-28 |
|
PDBID: | 8s4u | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-22 |
|
PDBID: | 8zof | Status: | HPUB -- hold until publication | Title: | Structure of the canthaxanthin mutant PSI-3VCPI supercomplex in Nannochloropsis oceanica | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | Deposition date: | 2024-05-28 |
|
PDBID: | 8zog | Status: | HPUB -- hold until publication | Title: | Structure of the astaxanthin mutant PSI-9VCPI supercomplex in Nannochloropsis oceanica | Authors: | Shen, L.L., Shen, J.R., Wang, W.D. | Deposition date: | 2024-05-28 |
|
PDBID: | 8zo5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-28 |
|
PDBID: | 8s56 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-22 |
|
PDBID: | 8s4y | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-22 |
|
PDBID: | 8s53 | Status: | HPUB -- hold until publication | Title: | X-ray crystal structure of CYP142 from Mycobacterium tuberculosis in complex with a fragment bound in two poses | Authors: | Snee, M., Kavanagh, M., Levy, C., Leys, D. | Deposition date: | 2024-02-22 |
|
PDBID: | 8znt | Status: | HPUB -- hold until publication | Title: | Catalytic antibody T99_C220A | Authors: | Kobayashi, J., Yoshida, H., Tsuyuguchi, M., Kato, R. | Deposition date: | 2024-05-28 |
|