| PDBID: | 9iqk | | Status: | HPUB -- hold until publication | | Title: | SacM in complex with LC3 | | Authors: | Zhang, B., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 8zps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-31 |
|
| PDBID: | 8tcb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 9iqi | | Status: | HPUB -- hold until publication | | Title: | Structure of oleate hydratase mutant - V135A/L212V from Staphylococcus aureus in the complex with FAD | | Authors: | Xue, S., Feng, T. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 8zt7 | | Status: | HPUB -- hold until publication | | Title: | structure of FBP1 in apo state | | Authors: | Wang, W.H., Zhang, J.Z., Yang, M.J. | | Deposition date: | 2024-06-06 |
|
| PDBID: | 9iql | | Status: | HPUB -- hold until publication | | Title: | SacM in complex with L6S | | Authors: | Zhang, B., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iqm | | Status: | HPUB -- hold until publication | | Title: | CatM-L6S, a SnoaL-like protein in complex with substrate mimic L6S | | Authors: | Zhang, B., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iqn | | Status: | HPUB -- hold until publication | | Title: | CatM-W86A-L6R, a SnoaL-like protein in complex with substrate mimic L6R | | Authors: | Zhang, B., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 8z6z | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH-WT | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9iqx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-13 |
|
| PDBID: | 8te8 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI) | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-05 | | Release date: | 2024-08-01 |
|
| PDBID: | 9iqy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-13 |
|
| PDBID: | 8z71 | | Status: | HPUB -- hold until publication | | Title: | State 1a (S1a) of yeast 80S ribosome bound to open eEF3 and 2 tRNAs and eEF1A during mRNA decoding | | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-15 |
|
| PDBID: | 8z6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8z6o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HDGFRP2 PWWP domain in complex with Varenicline | | Authors: | Wei, X., Ruan, K. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Procerain-B from Calotropis gigantea | | Authors: | Kumar, A., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tez | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 | | Release date: | 2024-08-01 |
|
| PDBID: | 8z79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tf1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 | | Release date: | 2024-08-01 |
|
| PDBID: | 9iqp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-13 |
|
| PDBID: | 8tf6 | | Status: | HPUB -- hold until publication | | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8z7b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of NTD-SD1-RBD-ACE2) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
