| PDBID: | 8ylx | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM reconstruction of Oryza sativa recombinant human serum albumin | | Authors: | Dong, C.J., Yang, D.C., Duan, B.R. | | Deposition date: | 2024-03-07 |
|
| PDBID: | 8rce | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR alfa Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
HHHHHHSSGLVPRGSHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
|
|
| PDBID: | 8ylw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-07 |
|
| PDBID: | 9fwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-30 |
|
| PDBID: | 8y6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8rd1 | | Status: | HPUB -- hold until publication | | Title: | HUWE1 WWE domain in complex with compound 4 | | Authors: | Muenzker, L., Zak, K.M., Boettcher, J. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 9fwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-30 |
|
| PDBID: | 8ym4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8rd0 | | Status: | HPUB -- hold until publication | | Title: | HUWE1 WWE domain in complex with compound 3 | | Authors: | Muenzker, L., Boettcher, J. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8ym5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8ym6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8ym8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8rcy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8ym1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8rd5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8yma | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8rdc | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8ymb | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of SHD931 in complex with Brd4-BD2 and VCB | | Authors: | Huang, W.X., Chen, Y.H., Li, C.G., Ding, K. | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8rcr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8ym3 | | Status: | HPUB -- hold until publication | | Title: | Structural basis of Elongation factor Tu in regulating photoinhibition in Synechococcus sp. PCC 7942. | | Authors: | Cheng, C., Ma, H. | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8ym9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8ymc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8rd4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8ymf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-09 |
|
| PDBID: | 8rd3 | | Status: | HPUB -- hold until publication | | Title: | Structure of a yeast protein complex | | Authors: | Barbarin-Bocahu, I., Graille, M. | | Deposition date: | 2023-12-07 |
|
