| PDBID: | 8r5g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8yi2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8r5n | | Status: | HPUB -- hold until publication | | Title: | DTX1 WWE domain in complex with ATP | | Authors: | Muenzker, L., Zak, K.M., Boettcher, J. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8yi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8r6a | | Status: | HPUB -- hold until publication | | Title: | DTX1 WWE domain in complex with ADP bound to WWE1 | | Authors: | Muenzker, L., Zak, K.M., Boettcher, J. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8r6b | | Status: | HPUB -- hold until publication | | Title: | DTX1 WWE domain in complex with ADP bound to WWE2 | | Authors: | Muenzker, L., Zak, K.M., Boettcher, J. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8yig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8r68 | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorC WT | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8yid | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase from Burkholderia ubonensis in complex with NADH and 6-methyl-2,3,4,5-tetrahydropyridine | | Authors: | Ma, Z.F., Shen, X.Y. | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
| PDBID: | 8r6i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8yik | | Status: | HPUB -- hold until publication | | Title: | pP1192R-ATPase-domain | | Authors: | Sun, J.Q., Liu, R.L. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9ik1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human P2X3 receptor-compound 26a complex | | Authors: | Kim, S., Kim, G.R., Kim, Y.O., Han, X., Nagel, J., Kim, J., Song, D.I., Muller, C.E., Yoon, M.H., Jin, M.S., Kim, Y.C. | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r6j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8r6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8yi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8r6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8yip | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8r6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8r6e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8yis | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a2b | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8r6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 9ik9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of SST analogs bond SSTR1-Gi complex | | Authors: | Wong, T.S., Zeng, Z.C., Xiong, T.T., Gan, S.Y., Du, Y. | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r6p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8r6o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8r6r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
