Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 12279 results
PDBID:8qrj
Status:HPUB -- hold until publication
Title:LCC-ICCG PETase mutant H218Y
Authors:Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L.
Deposition date:2023-10-09
Sequence:

>Entity 1


MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
PDBID:8qri
Status:HPUB -- hold until publication
Title:TRRAP and EP400 in the human Tip60 complex
Authors:Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., SChultz, P., Papai, G., Ben-Shem, A.
Deposition date:2023-10-09
PDBID:8y9r
Status:HPUB -- hold until publication
Deposition date:2024-02-07
PDBID:8qrz
Status:HPUB -- hold until publication
Deposition date:2023-10-09
PDBID:8qs5
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8ya3
Status:HPUB -- hold until publication
Deposition date:2024-02-07
PDBID:8qs7
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 70 (1084352)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs8
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 78 (1084378)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8ya9
Status:HPUB -- hold until publication
Deposition date:2024-02-08
PDBID:9iht
Status:HPUB -- hold until publication
Title:Crystal structure of GH57 family amylopullulanase from Aquifex aeolicus in complex with acarbose
Authors:Zhu, Z.M., Wang, W.W., Yu, F.
Deposition date:2024-06-18
PDBID:8qs9
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 83 (1084383)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8yab
Status:HPUB -- hold until publication
Deposition date:2024-02-08
PDBID:8qsa
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 86 (1084384)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8yap
Status:HPUB -- hold until publication
Deposition date:2024-02-09
PDBID:8qsh
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 23 (1083848).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:9ihw
Status:HPUB -- hold until publication
Title:Crystal structure of GH57 family amylopullulanase mutant D352N from Aquifex aeolicusin complex with Maltohexaose
Authors:Zhu, Z.M., Wang, W.W., Yu, F.
Deposition date:2024-06-18
PDBID:8qse
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 23 (1083848).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsf
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 22 (1083853).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsd
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 79 (1124379).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsc
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 22 (1083853).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8yai
Status:HPUB -- hold until publication
Title:Crystal structure of glucose 1-dehydrogenase mutant1 from Limosilactobacillus fermentum
Authors:Cong, L., Wang, J.J., Wei, H.L., Liu, W.D., You, S.
Deposition date:2024-02-09
PDBID:8yah
Status:HPUB -- hold until publication
Deposition date:2024-02-09
PDBID:8qsg
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 86 (1124384).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8yam
Status:HPUB -- hold until publication
Deposition date:2024-02-09
PDBID:8qsi
Status:HPUB -- hold until publication
Deposition date:2023-10-10

222415

건을2024-07-10부터공개중

PDB statisticsPDBj update infoContact PDBjnumon