| PDBID: | 9ff6 | | Status: | HPUB -- hold until publication | | Title: | Human transthyretin (TTR) in complex with (E)-4-((((2-methoxybenzyl)oxy)imino)methyl)benzoic acid (Lic157) | | Authors: | Ciccone, L., Shepard, W., Sirigu, S., Camodeca, C., Mazzoccchi, F., Fruchart, C., Nencetti, S., Orlandini, E. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8qp4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-29 | | Release date: | 2025-03-29 |
|
| PDBID: | 8yf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9ffa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8qp6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E1 glycoprotein epitope 314-324 scaffold design 1W4K_08 in complex with neutralizing antibody F(ab) fragment IGH526 | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2023-09-30 | | Sequence: | >Entity 1
MGSREVATPHRAAWLAMMLGIDASKVKGTGPGGVITVEDVKRWAEETAKATAGSENLYFQ
>Entity 2
EVQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGSLEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKEIELTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHNNDLRPSGVPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
|
|
| PDBID: | 8yf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9ff8 | | Status: | HPUB -- hold until publication | | Title: | Human transthyretin (TTR) in complex with (E)-2-((((2-chlorobenzyl)oxy)imino)methyl)benzoic acid (Lic166) | | Authors: | Ciccone, L., Shepard, W., Sirigu, S., Camodeca, C., Mazzoccchi, F., Fruchart, C., Nencetti, S., Orlandini, E. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8qhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-07 |
|
| PDBID: | 8yf9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9ff9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8qpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-02 |
|
| PDBID: | 8yfe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-24 |
|
| PDBID: | 8qpg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-02 |
|
| PDBID: | 8yfh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-24 |
|
| PDBID: | 8qpq | | Status: | HPUB -- hold until publication | | Title: | C1 turret to baseplate interface of full Haloferax tailed virus 1 adjacent to the portal-capsid interface. | | Authors: | Zhang, D., Daum, B., Isupov, M.N., McLaren, M. | | Deposition date: | 2023-10-02 |
|
| PDBID: | 8yfm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FIP200 claw/TNIP1_FIR_pS122 | | Authors: | Lv, M.Q., Wu, S.M. | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9ffu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8qpv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
| PDBID: | 8yfn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FIP200 claw in complex with TNIP1_FIR_pS123 peptide with an elongated C terminus | | Authors: | Lv, M.Q., Wu, S.M. | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9fg9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8qpt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of pyrophosphatase from Ogataea parapolymorpha | | Authors: | Matyuta, I.O., Rodina, E.V., Vorobyeva, N.N., Kurilova, S.A., Bezpalaya, E.Y., Boyko, K.M. | | Deposition date: | 2023-10-03 | | Sequence: | >Entity 1
MLKLSRALSSVVSGTRNSPSFKTYLRLKDGKIGSFFHDVPLGLDKQKRIANMVVEIPRWVNAKYEISKDFKANPIVQDTKKGKLRYLNNIYPNHGVPHNYGAFPQTWESPLESSSLVNQNILGDNDPLDVIDIGRFVSSTGTVKPVKILGSLALVDDGELDWKVVVIDTNDPFAAELNDIKDVYEKMPGVLENLKRWFEVYKIPTGKEPNSFLFDGNYKDTEFTLKVVQECHENWYKLVMGELHGDNLPSTENATLPHTKGNTVFDVEIEVSQKAEQVPPEVNDMSFIK
|
|
| PDBID: | 8yfx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-25 |
|
| PDBID: | 9fg7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yfw | | Status: | HPUB -- hold until publication | | Title: | A human transporter for substrate translocation | | Authors: | Lu, Y., Cao, Y. | | Deposition date: | 2024-02-25 |
|
| PDBID: | 9fg8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
