| PDBID: | 9fde | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8kcd | | Status: | HPUB -- hold until publication | | Title: | Complex of DDM1-nucleosome(H2A.W) complex with DDM1 bound to SHL2 and SHL-2 | | Authors: | Zhang, H., Zhang, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8xpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fcw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xq0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of spleen tyrosine kinase(SYK)in complex with SKI-G-1653 | | Authors: | Bong, S.M., Lee, B.I. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fd2 | | Status: | HPUB -- hold until publication | | Title: | Structure of Pol II-TC-NER-STK19 complex | | Authors: | Lee, S.-H., Sixma, T.K. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xq2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of spleen tyrosine kinase(SYK)in complex with SKI-G-1693 | | Authors: | Bong, S.M., Lee, B.I. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fcv | | Status: | HPUB -- hold until publication | | Title: | Cas nuclease-CRISPR (cr)RNA ribonucleoprotein (RNP) complex | | Authors: | Schmelz, S., Lukat, P., Blankenfeldt, W. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xps | | Status: | HPUB -- hold until publication | | Title: | Structure of Nipah virus Bangladesh string G protein ectodomain monomer bound to single-domain antibody n425 at 3.22 Angstroms overall resolution | | Authors: | Sun, L., Chen, Z., Sun, Y., Mao, Q. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fcx | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSINHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8kcj | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 9f3b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8kck | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N9 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 | | Sequence: | >Entity 1
GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
| PDBID: | 8xpq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fcy | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-R21K mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALKRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8q55 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8xpw | | Status: | HPUB -- hold until publication | | Title: | Marine bacterial laminarinase PtLam treated with 100 mM EDTA | | Authors: | Yang, J. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fd3 | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-D190N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHNIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8q5c | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 12 (1075475) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8xq3 | | Status: | HPUB -- hold until publication | | Title: | Structure of Nipah virus Bangladesh string G protein ectodomain tetramer bound to single-domain antibody n425 at 5.87 Angstroms overall resolution | | Authors: | Sun, L., Chen, Z., Sun, Y., Mao, Q. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fdc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8q53 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of truncated human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) in apo form | | Authors: | Kumar, A., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8xpy | | Status: | HPUB -- hold until publication | | Title: | Structure of Nipah virus Malaysia string G protein ectodomain monomer bound to single-domain antibody n425 at 3.63 Angstroms overall resolution | | Authors: | Sun, L., Chen, Z., Sun, Y., Mao, Q. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8q56 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8xpr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human eIF4A1-ATP analog-Rohinitib-polypurine RNA complex | | Authors: | Ito, T., Sakamoto, A. | | Deposition date: | 2024-01-04 |
|
