| PDBID: | 8xh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-17 |
|
| PDBID: | 9f74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8pxe | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal dimerisation domain of Hh1141 | | Authors: | Wilk, P., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MASFEDTLKATIKSNTKQDIKILKIQNLQSSPDVKLVLIAVGNMQVPIFASKDGKLVMGVSNVFFAHKSEDMGAVGSLIKQTQSESKPDKAILDTLFKKIPQDEYIILRSPNKNAKKITYIVSDPNCPSCQKELNNIQERLKDSDVYMLLVGFVGEDSPIKSSMLRDRLLDVKDDKEKLKILREVYTPKSKVPTSYINIDIKDTMKINQKVIDAGIKSVPFVYERNKLEHHHHHHH
|
|
| PDBID: | 9f75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8pxd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C-terminal domain of Hh1412 | | Authors: | Wilk, P., Orlikowska, M., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MDKAELQKTLQANKIQGNIVSSSDLGSGLSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPSNKTIYIVSDFNCPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDIKAAMALTQAVADTGVRSVPYIIEPHHHHHH
|
|
| PDBID: | 9f76 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8pxf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the full length Hh1412 Dsb homodimer. | | Authors: | Wilk, P., Orlikowska, M., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MDKAELQKTLQANKIQGNIVSSSDLGSGLSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPSNKTIYIVSDFNCPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDIKAAMALTQAVADTGVRSVPYIIEPHHHHHH
|
|
| PDBID: | 9f77 | | Status: | HPUB -- hold until publication | | Title: | BAZ2A bromodomain in complex with acetylpyrrole derivative compound 27-TND19 | | Authors: | Dalle Vedove, A., Cazzanelli, G., Caflisch, A., Lolli, G. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8pxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8xhq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 9f78 | | Status: | HPUB -- hold until publication | | Title: | BAZ2A bromodomain in complex with acetylpyrrole derivative compound 28-TN23 | | Authors: | Dalle Vedove, A., Cazzanelli, G., Caflisch, A., Lolli, G. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8pxb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8xhp | | Status: | HPUB -- hold until publication | | Title: | The apo structure of SsBcmC | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 9f7g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8py2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound JMS-175-2 | | Authors: | Chandler, F., Zeqiraj, E. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 9f7k | | Status: | HPUB -- hold until publication | | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | | Deposition date: | 2024-05-03 | | Sequence: | >Entity 1
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
| PDBID: | 8xhl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8pxz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 9f7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8py0 | | Status: | HPUB -- hold until publication | | Title: | Sensor domain of Oscillibacter ruminantium chemoreceptor in complex with formate. | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 8xht | | Status: | HPUB -- hold until publication | | Title: | The apo structure of PaBcmG | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 9f7p | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8xhx | | Status: | HPUB -- hold until publication | | Title: | The complex structure of PaBcmG and its natural substrate | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8pxq | | Status: | HPUB -- hold until publication | | Title: | SFX Ferric structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Pfalzgraf, H. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
