| PDBID: | 8x95 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 mature virion in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9f0s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8x96 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 A-particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x97 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 empty particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9f0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8x98 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of coxsackievirus A16 mature virion in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8phc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 9f0n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ta_Cel5A E133A variant, apoform | | Authors: | Dutoit, R. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8x99 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of coxsackievirus A16 A-particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9f0l | | Status: | HPUB -- hold until publication | | Title: | Scalable protein design using hallucination in a relaxed sequence space | | Authors: | Frank, C.J., Motoyuki, H., Dietz, H. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8x9a | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of coxsackievirus A16 empty particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9f0m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ta_Cel5A E133Q Y200F variant in complex with cellopentaose | | Authors: | Dutoit, R. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 9f1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8x9b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of coxsackievirus A16 empty particle in complex with Fab h1A6.2 (local refinement) | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x8y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 with GNS-2660 inhibitor | | Authors: | Park, T.H., Bong, S.M., Lee, S.J., Lee, B.I. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8phm | | Status: | HPUB -- hold until publication | | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 | | Sequence: | >Entity 1
NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 9f1c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8x92 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8phz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 | | Release date: | 2024-09-20 |
|
| PDBID: | 9f1d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8pik | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-21 | | Release date: | 2024-12-21 |
|
| PDBID: | 9f18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9f14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8pj4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 9f15 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
