| PDBID: | 3n7g | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal Structure of Oxygen-Bound Hell''s Gate Globin I | | Authors: | Teh, A.H., Saito, J.A., Baharuddin, A., Tuckerman, J.R., Newhouse, J.S., Kanbe, M., Newhouse, I., Rashidah, A.R., Didierjean, C., Stott, M., Gonzalez, G., Gilles-Gonzalez, M.A., Najimudin, N., Alam, M. | | Deposition date: | 2010-05-27 |
|
| PDBID: | 8uyw | | Status: | HPUB -- hold until publication | | Title: | HBV T=3 3A mutant capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRAPRRRTPAPRRRRSQAPRRRRSQSREPQC
|
|
| PDBID: | 1z80 | | Status: | WDRN -- deposition withdrawn | | Title: | 3MBT of human Lethal-3-Malignant Brain Tumor Like-1 (h-L3MBTL1) complex with di-methyl lysine [K(Me)2)] at 2.8 angstrom | | Authors: | Wang, W.K., Tereshko, V., Patel, D.J. | | Deposition date: | 2005-03-29 |
|
| PDBID: | 8zsv | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of the RO5263397-bound mTAAR1-Gs complex | | Authors: | Xu, F., Jiang, K.X., Zheng, Y. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 3qiq | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal Structure of the Repeating CUG Motif in Myotonic Dystrophy | | Authors: | Kumar, A., Fang, P., Parkesh, R., Guo, M., Disney, M.D. | | Deposition date: | 2011-01-27 |
|
| PDBID: | 5war | | Status: | WDRN -- deposition withdrawn | | Deposition date: | 2017-06-26 |
|
| PDBID: | 8v3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 2b9q | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal Structure of Lys12Cys/ Cys117Val mutant of Human Acidic Fibroblast Growth Factor | | Authors: | Blaber, M., Dubey, V.K., Lee, J., Somasundaram, T. | | Deposition date: | 2005-10-12 |
|
| PDBID: | 8isu | | Status: | WDRN -- deposition withdrawn | | Title: | ATP-bound hMRP4 | | Authors: | Liu, Z.M., Huang, Y. | | Deposition date: | 2023-03-21 |
|
| PDBID: | 8vsb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 5xvy | | Status: | WDRN -- deposition withdrawn | | Deposition date: | 2017-06-28 | | Release date: | 2018-07-28 |
|
| PDBID: | 8zso | | Status: | PROC -- to be processed | | Title: | Respirasome close state 2 in presence of metformin | | Authors: | Teng, F., He, Z.X., Hu, Y.Q., Xu, C.Y., Guo, R.Y., Zhou, L. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 3v7g | | Status: | WDRN -- deposition withdrawn | | Title: | X-ray crystallographic structure of 206AA orotidine monophosphate decarboxylase from E.coli | | Authors: | Cardenas, A.M., Horton, L.B., Brown, N.G., Palzkill, T.G. | | Deposition date: | 2011-12-21 |
|
| PDBID: | 8ghk | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of Influenza A virus A/Melbourner/1/1946 (H1N1) hemagglutinin bound to GS10-X6-BE4 Fab | | Authors: | Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease | | Deposition date: | 2023-03-10 |
|
| PDBID: | 2d72 | | Status: | WDRN -- deposition withdrawn | | Title: | Hydrolysis reaction of 8-oxo-dGTP in the MutT crystal | | Authors: | Nakamura, T., Yamagata, Y. | | Deposition date: | 2005-11-15 |
|
| PDBID: | 8ghl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-10 | | Release date: | 2024-09-11 |
|
| PDBID: | 9bac | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of Hyper2 tube, ~24 nm diameter | | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 8uyz | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (HBV dimer co-assembled with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 3qzd | | Status: | WDRN -- deposition withdrawn | | Title: | Human topoisomerase IIbeta in complex with DNA and mitoxantrone | | Authors: | Wu, C.C., Li, T.K., Farh, L., Lin, L.Y., Lin, T.S., Yu, Y.J., Yen, T.J., Chiang, C.W., Chan, N.L. | | Deposition date: | 2011-03-05 |
|
| PDBID: | 5xuc | | Status: | WDRN -- deposition withdrawn | | Title: | The malate-bound dimer of chemoreceptor MCP2201 ligand binding domain | | Authors: | Hong, Y., Li, D.F., Wang, D.C. | | Deposition date: | 2017-06-23 |
|
| PDBID: | 2f04 | | Status: | WDRN -- deposition withdrawn | | Title: | hormaomycin in DMSO | | Authors: | reinscheid (U.M.) | | Deposition date: | 2005-11-11 |
|
| PDBID: | 8zsn | | Status: | PROC -- to be processed | | Title: | Respirasome closed state 1 in the absence of biguanide | | Authors: | Teng, F., He, Z.X., Hu, Y.Q., Xu, C.Y., Guo, R.Y., Zhou, L. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 5ztv | | Status: | WDRN -- deposition withdrawn | | Title: | Human H ferritin with iron loading ratio of 96 Fe(II)/shell | | Authors: | Chen, H., Zang, J., Zhou, K., Zhao, G. | | Deposition date: | 2018-05-05 |
|
| PDBID: | 3swu | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of Tm0439, a GntR transcriptional regulator | | Authors: | Czelakowski, G.P., Derewenda, Z.S., Integrated Center for Structure and Function Innovation (ISFI) | | Deposition date: | 2011-07-14 |
|
| PDBID: | 8v42 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Vaccinia-related Kinase 1 (VRK1) Bound to ACH000400 | | Authors: | Counago, R.M., de Souza, G.P., Azevedo, A., Guimaraes, C., Mascarello, A., Gama, F., Ferreira, M., Arruda, P. | | Deposition date: | 2023-11-28 | | Sequence: | >Entity 1
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
|
|
