| PDBID: | 8i9n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ecCTPS with ATP UTP GTP and DON | | Authors: | Guo, C.J., Liu, J.L. | | Deposition date: | 2023-02-07 | | Release date: | 2024-08-07 |
|
| PDBID: | 8ic2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-02-10 | | Release date: | 2024-08-10 |
|
| PDBID: | 8ic5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-02-10 | | Release date: | 2024-08-10 |
|
| PDBID: | 8g9g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-02-21 | | Release date: | 2024-08-21 |
|
| PDBID: | 8g9i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-02-21 | | Release date: | 2024-08-21 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 8vxo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of modified JEV virus E protein dimer | | Authors: | Galkin, A., Pozharski, E., Li, Y. | | Deposition date: | 2024-02-05 | | Release date: | 2025-02-05 |
|
| PDBID: | 8ijy | | Status: | HOLD -- hold until a certain date | | Title: | Synechococcus elongatus 6-4 photolyase with an 8-HDF as the antenna chromophore and a covalently linked FAD as the catalytic cofactor | | Authors: | Liu, Y., Xu, L., Zhang, P. | | Deposition date: | 2023-02-28 | | Release date: | 2024-08-28 |
|
| PDBID: | 8ikn | | Status: | HOLD -- hold until a certain date | | Title: | S3.11-T-box in complex with WT Mycobacterium smegmatis isoleucine tRNA | | Authors: | Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, K., Wei, X.W., Yang, Y., Henkin, T.M., Su, Z. | | Deposition date: | 2023-02-28 | | Release date: | 2024-08-28 |
|
| PDBID: | 8ikk | | Status: | HOLD -- hold until a certain date | | Title: | Mycobacterium smegmatis ileS T-box RNA in complex with its cognate tRNA | | Authors: | Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, M., Wei, X., Yang, Y., Henkin, T.M., Su, Z. | | Deposition date: | 2023-02-28 | | Release date: | 2024-08-28 |
|
| PDBID: | 8iki | | Status: | HOLD -- hold until a certain date | | Title: | Mycobacterium smegmatis ileS T-box RNA in complex with acc.11-tRNA | | Authors: | Jia, X., Luo, B., Su, Z. | | Deposition date: | 2023-02-28 | | Release date: | 2024-08-28 |
|
| PDBID: | 8iko | | Status: | HOLD -- hold until a certain date | | Title: | S3.11-T-box in complex with acc.11-tRNA | | Authors: | Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, M., Wei, X., Yang, Y., Henkin, T.M., Su, Z. | | Deposition date: | 2023-02-28 | | Release date: | 2024-08-28 |
|
| PDBID: | 8ilo | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Monkeypox I7 protease in the apo-form | | Authors: | Lan, W., You, T., Li, D., Dong, X., Wang, H., Xu, J., Wang, W., Gao, Y., Yang, H. | | Deposition date: | 2023-03-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8ilp | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Monkeypox I7 protease in the complex with E64D | | Authors: | Lan, W., You, T., Li, D., Dong, X., Wang, H., Xu, J., Wang, W., Gao, Y., Yang, H. | | Deposition date: | 2023-03-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8ipf | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a DARPin protein | | Authors: | Ngo, K.H., Liew, C.W., Heddi, B., Phan, A.T. | | Deposition date: | 2023-03-14 | | Release date: | 2024-09-18 |
|
| PDBID: | 8ix5 | | Status: | HOLD -- hold until a certain date | | Title: | X-ray structure of FBB18 from Chlamydomonas reinhardtii. | | Authors: | Sahashi, Y., Tanaka, H., Shimo-Kon, R., Yamamoto, R., Kurisu, G., Kon, T. | | Deposition date: | 2023-03-31 | | Release date: | 2024-09-30 |
|
| PDBID: | 8iz3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8iyy | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein(SITE-pHorin)_pH7.0 | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8iyz | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 S65T | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8iz0 | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 W66Y | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8iz2 | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH8.0 | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8iyv | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of trypsin-famotidine complex at 2.10 Angstroms resolution | | Authors: | Ahmad, M.S., Kalam, N., Akbar, Z., Rasheed, S., Choudhary, M.I. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8izk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-07 | | Release date: | 2024-10-07 |
|
| PDBID: | 8j47 | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM Structure of 40-Residue Arctic (E22G) Beta-Amyloid Fibril Derived by Co-Analysis with Solid-State NMR | E22G Abeta40 | | Authors: | Tehrani, M.J., Matsuda, I., Yamagata, A., Matsunaga, T., Sato, M., Toyooka, K., Shirouzu, M., Ishii, Y., Kodama, Y., McElheny, D., Kobayashi, N. | | Deposition date: | 2023-04-19 | | Release date: | 2024-10-23 |
|
| PDBID: | 8j4n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
