Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 15337 results
PDBID:9l68
Status:HPUB -- hold until publication
Title:Crystal structure of human STING in complex with F8W
Authors:Feng, Z.W., Zeng, T., Chen, M.R., Xiao, Y.B., Xu, X.L.
Deposition date:2024-12-24
PDBID:9l6d
Status:HPUB -- hold until publication
Deposition date:2024-12-24
PDBID:9l63
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l64
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l65
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l6e
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l6a
Status:HPUB -- hold until publication
Title:Crystal structure of KRas G12D (GDP) in complex with compound 1
Authors:Amano, Y., Tateishi, Y.
Deposition date:2024-12-24
PDBID:9l6f
Status:HPUB -- hold until publication
Title:Crystal structure of KRas G12D (GDP) in complex with ASP3082
Authors:Amano, Y., Tateishi, Y.
Deposition date:2024-12-24
PDBID:9l6j
Status:HPUB -- hold until publication
Title:Structural studies on the conformation changes induced by ligand binding in an Adenine phosphoribosyltransferase (FnAPRT) from Fusobacterium nucleatum
Authors:Kim, B., Hwang, J., Do, H., Lee, J.H.
Deposition date:2024-12-24
PDBID:9l6m
Status:HPUB -- hold until publication
Title:Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound.
Authors:Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K.
Deposition date:2024-12-24
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
PDBID:9l6n
Status:HOLD -- hold until a certain date
Title:PEDV 3CLpro mutant (C144A) in complex with nsp5/6 peptite substrate
Authors:Zhang, Y., Zhang, D., Shi, Y.J., Peng, G.Q.
Deposition date:2024-12-24
Release date:2025-12-24
PDBID:9l6p
Status:HPUB -- hold until publication
Title:Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH
Authors:Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C.
Deposition date:2024-12-24
PDBID:9mo3
Status:HPUB -- hold until publication
Title:LINE-1 Reverse Transcriptase bound to an incorporated inhibitor-terminated DNA primer RNA template duplex and dTTP as the incoming base
Authors:Nichols, C., Viacava Follis, A.
Deposition date:2024-12-24
PDBID:9mo1
Status:HPUB -- hold until publication
Title:LINE-1 Reverse Transcriptase bound to a DNA primer RNA template duplex and triphosphate nucleoside inhibitor as the incoming base
Authors:Nichols, C., Viacava Follis, A.
Deposition date:2024-12-24
PDBID:9mo2
Status:HPUB -- hold until publication
Deposition date:2024-12-24
PDBID:9hv7
Status:HPUB -- hold until publication
Title:Crystal structure of Tetraspanin TSPAN10mutant Large Extracellular Loop (LEL)
Authors:Nagarathinam, K., Krey, T.
Deposition date:2024-12-24
PDBID:9hv4
Status:HPUB -- hold until publication
Title:CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. cofactor-monomer.
Authors:Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N.
Deposition date:2024-12-24
PDBID:9hv5
Status:HPUB -- hold until publication
Title:CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Cofactor/ligand-monomer
Authors:Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N.
Deposition date:2024-12-24
PDBID:9hv6
Status:HPUB -- hold until publication
Title:CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Total-monomer
Authors:Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N.
Deposition date:2024-12-24
PDBID:9hv2
Status:HPUB -- hold until publication
Title:Crystal structure of tri-specific FMDV mAb-34 Fab
Authors:Ren, J., Duyvesteyn, H.M.E., Stuart, D.I.
Deposition date:2024-12-24
PDBID:9hv8
Status:HPUB -- hold until publication
Title:Crystal structure of tri-specific FMDV mAb-49 Fab
Authors:Ren, J., Duyvesteyn, H.M.E., Stuart, D.I.
Deposition date:2024-12-24
PDBID:9hv9
Status:HPUB -- hold until publication
Title:Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1
Authors:Ren, J., Duyvesteyn, H.M.E., Stuart, D.I.
Deposition date:2024-12-24
PDBID:9l5m
Status:HPUB -- hold until publication
Deposition date:2024-12-23
PDBID:9l57
Status:HPUB -- hold until publication
Deposition date:2024-12-23
PDBID:9l58
Status:HPUB -- hold until publication
Deposition date:2024-12-23

240971

數據於2025-08-27公開中

PDB statisticsPDBj update infoContact PDBjnumon