| PDBID: | 9lte | | Status: | HPUB -- hold until publication | | Title: | Human PKM2 complex with methionine | | Authors: | Wang, J., Wu, C. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human RAB43 in complex with GppNHp | | Authors: | Wang, J., Yan, W.P. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
GGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFS
|
|
| PDBID: | 9lts | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9lto | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human RAB43 in GDP-AlF3 transition state complex with USP6NL TBC domain | | Authors: | Wang, J., Yan, W.P. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human anti-Pfs48/45 transmission-blocking antibody RUPA-71 | | Authors: | Hailemariam, S., Ivanochko, D., Julien, J.P. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7n | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C6-AGCT DNA conjugate at 1.82 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7m | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Hofmann, J.L., Watkins, A.M., Seeger, F., Dou, Y., Zhang, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7o | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Hofmann, J.L., Watkins, A.M., Seeger, F., Dou, Y., Zhang, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7u | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C2-AGCT DNA conjugate at 2.17 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7w | | Status: | HPUB -- hold until publication | | Title: | antibody 5E10 Fab | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTFKLLIYYTSRLHSGVPSRFSGGGSGTDYSLTISNLEKEDIATYFCQQGNTLPRTFGGGTRLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Entity 2
(PCA)VQLLQPGAELVRPGASVRLSCKTSGYTFTSYWINWVKQRPGQGLEWIGKIFPSDSHTNYNQKFKDKATLTVDKSSSTAYMQLISPTSEDSAVYYCTRDFDTQFYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
|
|
| PDBID: | 9n7x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
