| PDBID: | 9qks | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qko | | Status: | HPUB -- hold until publication | | Title: | Structure of the cyanobacteria specific PRK from Chroococcidiopsis (Hyella disjuncta) PCC 6712 (P1 crystal form) | | Authors: | Tufail, F., Yang, L., Murray, J.W. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkp | | Status: | HPUB -- hold until publication | | Title: | Structure of the cyanobacteria specific PRK from Chroococcidiopsis (Hyella disjuncta) PCC 6712 (P41212 crystal form) | | Authors: | Tufail, F., Yang, L., Murray, J.W. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qku | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qlc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qla | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qld | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-nitrophenol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9qlb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u52 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR Solution Structures of CX-5461-MYT1L Complex | | Authors: | Li, Y., Cao, C. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u58 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of AZ-GS bound AtABCC2 | | Authors: | Yang, G.-F., Dong, J.Q., Yang, T.-L. | | Deposition date: | 2025-03-20 |
|
