| PDBID: | 9leu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lei | | Status: | HPUB -- hold until publication | | Title: | Nitrile synthetase ArtA | | Authors: | Ma, H.L., Zhang, K.K. | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9le8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lea | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lef | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9le9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9led | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9leq | | Status: | HPUB -- hold until publication | | Title: | paralysed flagellum protein PflA N-terminal domain and PflB complex | | Authors: | He, J., Gao, X. | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lev | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9let | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lex | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9ley | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lez | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lf1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9mra | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9mr9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9mrh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Fluorescence lifetime-readout citrate sensor | | Authors: | Rosen, P.C., Yellen, G., Lim, D.C. | | Deposition date: | 2025-01-07 | | Release date: | 2026-01-07 |
|
| PDBID: | 9mrg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of KwaA tetramer with C2 symmetry | | Authors: | Zhang, Z., Patel, D.J. | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9hxk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-07 |
|
